Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9528
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 59
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM59
Synonyms (NCBI Gene) Gene synonyms aliases
C1orf8, DCF1, HSPC001, PRO195, UNQ169
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p32.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein shown to regulate autophagy in response to bacterial infection. This protein may also regulate the retention of amyloid precursor protein (APP) in the Golgi apparatus through its control of APP glycosylation. Overexpression of
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs776119905 C>A,G,T Risk-factor Genic downstream transcript variant, 3 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005138 hsa-miR-30a-5p pSILAC 18668040
MIRT005138 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT045645 hsa-miR-149-5p CLASH 23622248
MIRT052744 hsa-miR-1260b CLASH 23622248
MIRT663007 hsa-miR-6808-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000137 Component Golgi cis cisterna IDA 20427278
GO:0000138 Component Golgi trans cisterna IDA 20427278
GO:0000139 Component Golgi membrane IEA
GO:0004175 Function Endopeptidase activity IEA
GO:0005515 Function Protein binding IPI 23376921
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617084 1239 ENSG00000116209
Protein
UniProt ID Q9BXS4
Protein name Transmembrane protein 59 (Liver membrane-bound protein)
Protein function Acts as a regulator of autophagy in response to S.aureus infection by promoting activation of LC3 (MAP1LC3A, MAP1LC3B or MAP1LC3C). Acts by interacting with ATG16L1, leading to promote a functional complex between LC3 and ATG16L1 and promoting L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12280 BSMAP 72 256 Brain specific membrane anchored protein Family
Sequence
MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHT
YPKEEELYACQRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQ
LPFAELRQEQLMSLMPKMHLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIF
QSKPEIQYAPHLEQEPTNLRESSLSKMSYLQMRNSQAHRNFLEDGESDGFLRCLSLNSGW
ILTTTLVLSVMVLLWI
CCATVATAVEQYVPSEKLSIYGDLEFMNEQKLNRYPASSLVVVR
SKTEDHEEAGPLPTKVNLAHSEI
Sequence length 323
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Estrogen Resistance estrogen resistance syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 22451312
Asthma Associate 17543375
Central Nervous System Diseases Associate 34799992
Glioblastoma Associate 34799992
Glioma Associate 34799992
Hypertension Associate 32664164
Mitochondrial Diseases Associate 34799992
Myopathy with Giant Abnormal Mitochondria Associate 34799992
Neoplasms Associate 34799992
Parkinson Disease Associate 25663231