Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9495
Gene name Gene Name - the full gene name approved by the HGNC.
A-kinase anchoring protein 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AKAP5
Synonyms (NCBI Gene) Gene synonyms aliases
AKAP75, AKAP79, H21
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029184 hsa-miR-26b-5p Microarray 19088304
MIRT672951 hsa-miR-605-3p HITS-CLIP 23824327
MIRT672950 hsa-miR-4493 HITS-CLIP 23824327
MIRT672949 hsa-miR-214-5p HITS-CLIP 23824327
MIRT672948 hsa-miR-6811-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11287423, 16642035, 20410303, 20664520, 21771783, 22343722, 22976297, 26496610, 28514442, 32296183
GO:0005516 Function Calmodulin binding IEA
GO:0005829 Component Cytosol TAS
GO:0005886 Component Plasma membrane TAS
GO:0007165 Process Signal transduction NAS 1512224
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604688 375 ENSG00000179841
Protein
UniProt ID P24588
Protein name A-kinase anchor protein 5 (AKAP-5) (A-kinase anchor protein 79 kDa) (AKAP 79) (H21) (cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein)
Protein function Multivalent scaffold protein that anchors the cAMP-dependent protein kinase/PKA to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors (PubMed:1512224). Association with the
PDB 2H9R , 3LL8 , 5NIN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03832 WSK 75 102 WSK motif Motif
Tissue specificity TISSUE SPECIFICITY: Predominantly in the cerebral cortex and the postsynaptic densities of the forebrain, and to a lesser extent in adrenal medulla, lung and anterior pituitary.
Sequence
METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVAR
KCPQEAGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKK
AKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSTTSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQ
DVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTEIV
AEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPK
QFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
KINNLLQ
Sequence length 427
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Trafficking of AMPA receptors
ROBO receptors bind AKAP5