Gene Gene information from NCBI Gene database.
Entrez ID 9487
Gene name Phosphatidylinositol glycan anchor biosynthesis class L
Gene symbol PIGL
Synonyms (NCBI Gene)
CHIME
Chromosome 17
Chromosome location 17p11.2
Summary This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein
SNPs SNP information provided by dbSNP.
7
SNP ID Visualize variation Clinical significance Consequence
rs139004722 C>A,G,T Pathogenic, uncertain-significance 3 prime UTR variant, stop gained, coding sequence variant, downstream transcript variant, genic downstream transcript variant, missense variant
rs145303331 T>C Pathogenic, pathogenic-likely-pathogenic, uncertain-significance Missense variant, coding sequence variant, intron variant, genic downstream transcript variant
rs758633805 C>- Pathogenic Coding sequence variant, frameshift variant
rs768198327 G>A,T Likely-pathogenic Genic downstream transcript variant, splice donor variant, downstream transcript variant
rs770084126 G>A Pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
9
miRTarBase ID miRNA Experiments Reference
MIRT2295753 hsa-miR-2467-3p CLIP-seq
MIRT2295754 hsa-miR-3678-3p CLIP-seq
MIRT2295755 hsa-miR-450b-5p CLIP-seq
MIRT2295756 hsa-miR-4738-5p CLIP-seq
MIRT2295757 hsa-miR-4781-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0000225 Function N-acetylglucosaminylphosphatidylinositol deacetylase activity IBA
GO:0000225 Function N-acetylglucosaminylphosphatidylinositol deacetylase activity IEA
GO:0000225 Function N-acetylglucosaminylphosphatidylinositol deacetylase activity ISS
GO:0000225 Function N-acetylglucosaminylphosphatidylinositol deacetylase activity NAS 10085243
GO:0000225 Function N-acetylglucosaminylphosphatidylinositol deacetylase activity TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605947 8966 ENSG00000108474
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y2B2
Protein name N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase (EC 3.5.1.89) (Phosphatidylinositol-glycan biosynthesis class L protein) (PIG-L)
Protein function Catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02585 PIG-L 44 168 GlcNAc-PI de-N-acetylase Family
Sequence
MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPT
VLGLARLRHWVYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGM
QWDTEHVARVLLQHIEVNGINLVVTFDAGGVSGHSNHIALYAAVRALH
SEGKLPKGCSVL
TLQSVNVLRKYISLLDLPLSLLHTQDVLFVLNSKEVAQAKKAMSCHRSQLLWFRRLYIIF
SRYMRINSLSFL
Sequence length 252
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
Metabolic pathways
  Synthesis of glycosylphosphatidylinositol (GPI)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
62
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
CHIME syndrome Likely pathogenic; Pathogenic rs2142864883, rs768198327, rs773591135, rs2142610073, rs145303331, rs758633805, rs139004722, rs770084126 RCV001782627
RCV001823085
RCV002274225
RCV002052272
RCV000023501
RCV000023502
RCV000023503
RCV000023504
Hyperphosphatasia with intellectual disability syndrome 1 Likely pathogenic rs773591135 RCV002274225
Intellectual disability Pathogenic rs145303331 RCV005624705
PIGL-related disorder Likely pathogenic; Pathogenic rs773591135, rs145303331 RCV002508967
RCV002508918
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial cancer of breast Uncertain significance rs184077858 RCV005888207
Nonpapillary renal cell carcinoma Conflicting classifications of pathogenicity rs114670807 RCV005888206
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Burkitt Lymphoma Associate 19302917
Carcinoma Hepatocellular Associate 37280393
Coloboma Associate 35258128
Developmental Disabilities Associate 28327575
Glycosylphosphatidylinositol deficiency Associate 19302917
Hyperostosis corticalis deformans juvenilis Associate 30813920
Hyperphosphatasia with Mental Retardation Associate 30813920
Intellectual Disability Associate 22444671, 23561847, 30813920, 35258128
Muscle Hypotonia Associate 23561847
Neoplasms Associate 37280393