Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9480
Gene name Gene Name - the full gene name approved by the HGNC.
One cut homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ONECUT2
Synonyms (NCBI Gene) Gene synonyms aliases
OC-2, OC2
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q21.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the onecut family of transcription factors, which are characterized by a cut domain and an atypical homeodomain. The protein binds to specific DNA sequences and stimulates expression of target genes, including genes involved
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005390 hsa-miR-9-5p Luciferase reporter assay, Northern blot, qRT-PCR, Western blot 16831872
MIRT005390 hsa-miR-9-5p Sequencing 20371350
MIRT031575 hsa-miR-16-5p Sequencing 20371350
MIRT032175 hsa-let-7d-5p Sequencing 20371350
MIRT437992 hsa-miR-429 Luciferase reporter assay, Western blot, qRT-PCR 24402783
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 11478782
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604894 8139 ENSG00000119547
Protein
UniProt ID O95948
Protein name One cut domain family member 2 (Hepatocyte nuclear factor 6-beta) (HNF-6-beta) (One cut homeobox 2) (Transcription factor ONECUT-2) (OC-2)
Protein function Transcriptional activator. Activates the transcription of a number of liver genes such as HNF3B.
PDB 8T0F , 8T11
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02376 CUT 329 407 CUT domain Domain
PF00046 Homeodomain 427 481 Homeodomain Domain
Sequence
MKAAYTAYRCLTKDLEGCAMNPELTMESLGTLHGPAGGGSGGGGGGGGGGGGGGPGHEQE
LLASPSPHHAGRGAAGSLRGPPPPPTAHQELGTAAAAAAAASRSAMVTSMASILDGGDYR
PELSIPLHHAMSMSCDSSPPGMGMSNTYTTLTPLQPLPPISTVSDKFHHPHPHHHPHHHH
HHHHQRLSGNVSGSFTLMRDERGLPAMNNLYSPYKEMPGMSQSLSPLAATPLGNGLGGLH
NAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGH
TQSHGPVLAPSRERPPSSSSGSQVATSGQLEEINTKEVAQRITAELKRYSIPQAIFAQRV
LCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALR
LAACKRKEQEPNK
DRNNSQKKSRLVFTDLQRRTLFAIFKENKRPSKEMQITISQQLGLELTTVSNFFMNARRR
S
LEKWQDDLSTGGSSSTSSTCTKA
Sequence length 504
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 29581250
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 31882655
Arthropathy progressive pseudorheumatoid of childhood Associate 21745356
Carcinoma Hepatocellular Associate 26547929
Carcinoma Squamous Cell Associate 22143938
Colorectal Neoplasms Associate 24402783, 32377269
Coronary Artery Disease Associate 32971215
Lung Neoplasms Associate 31882655
Lymphoma Large B Cell Diffuse Associate 18288132
Neoplasm Metastasis Stimulate 31882655
Neoplasms Associate 18288132, 36508388