Gene Gene information from NCBI Gene database.
Entrez ID 9480
Gene name One cut homeobox 2
Gene symbol ONECUT2
Synonyms (NCBI Gene)
OC-2OC2
Chromosome 18
Chromosome location 18q21.31
Summary This gene encodes a member of the onecut family of transcription factors, which are characterized by a cut domain and an atypical homeodomain. The protein binds to specific DNA sequences and stimulates expression of target genes, including genes involved
miRNA miRNA information provided by mirtarbase database.
945
miRTarBase ID miRNA Experiments Reference
MIRT005390 hsa-miR-9-5p Luciferase reporter assayNorthern blotqRT-PCRWestern blot 16831872
MIRT005390 hsa-miR-9-5p Sequencing 20371350
MIRT031575 hsa-miR-16-5p Sequencing 20371350
MIRT032175 hsa-let-7d-5p Sequencing 20371350
MIRT437992 hsa-miR-429 Luciferase reporter assayWestern blotqRT-PCR 24402783
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 11478782
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604894 8139 ENSG00000119547
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95948
Protein name One cut domain family member 2 (Hepatocyte nuclear factor 6-beta) (HNF-6-beta) (One cut homeobox 2) (Transcription factor ONECUT-2) (OC-2)
Protein function Transcriptional activator. Activates the transcription of a number of liver genes such as HNF3B.
PDB 8T0F , 8T11
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02376 CUT 329 407 CUT domain Domain
PF00046 Homeodomain 427 481 Homeodomain Domain
Sequence
MKAAYTAYRCLTKDLEGCAMNPELTMESLGTLHGPAGGGSGGGGGGGGGGGGGGPGHEQE
LLASPSPHHAGRGAAGSLRGPPPPPTAHQELGTAAAAAAAASRSAMVTSMASILDGGDYR
PELSIPLHHAMSMSCDSSPPGMGMSNTYTTLTPLQPLPPISTVSDKFHHPHPHHHPHHHH
HHHHQRLSGNVSGSFTLMRDERGLPAMNNLYSPYKEMPGMSQSLSPLAATPLGNGLGGLH
NAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGH
TQSHGPVLAPSRERPPSSSSGSQVATSGQLEEINTKEVAQRITAELKRYSIPQAIFAQRV
LCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALR
LAACKRKEQEPNK
DRNNSQKKSRLVFTDLQRRTLFAIFKENKRPSKEMQITISQQLGLELTTVSNFFMNARRR
S
LEKWQDDLSTGGSSSTSSTCTKA
Sequence length 504
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Autosomal dominant polycystic kidney disease Uncertain significance rs764014713 RCV001844937
Autosomal dominant polycystic liver disease Uncertain significance rs1297497235, rs200319925, rs777194115 RCV001844938
RCV001844939
RCV001844940
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 31882655
Arthropathy progressive pseudorheumatoid of childhood Associate 21745356
Carcinoma Hepatocellular Associate 26547929
Carcinoma Squamous Cell Associate 22143938
Colorectal Neoplasms Associate 24402783, 32377269
Coronary Artery Disease Associate 32971215
Lung Neoplasms Associate 31882655
Lymphoma Large B Cell Diffuse Associate 18288132
Neoplasm Metastasis Stimulate 31882655
Neoplasms Associate 18288132, 36508388