Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9463
Gene name Gene Name - the full gene name approved by the HGNC.	Protein interacting with PRKCA 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PICK1
Synonyms (NCBI Gene) Gene synonyms aliases	PICK, PRKCABP
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It

Show/Hide all(42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT756128	hsa-miR-3131	Luciferase reporter assay, Western blotting, qRT-PCR	36718590
MIRT1233011	hsa-miR-4419a	CLIP-seq
MIRT1233012	hsa-miR-4510	CLIP-seq
MIRT1233013	hsa-miR-4728-5p	CLIP-seq
MIRT1233014	hsa-miR-4743	CLIP-seq
MIRT1233015	hsa-miR-939	CLIP-seq
MIRT1233016	hsa-miR-1245b-5p	CLIP-seq
MIRT1233017	hsa-miR-1321	CLIP-seq
MIRT1233018	hsa-miR-1827	CLIP-seq
MIRT1233019	hsa-miR-214	CLIP-seq
MIRT1233020	hsa-miR-3142	CLIP-seq
MIRT1233021	hsa-miR-3612	CLIP-seq
MIRT1233022	hsa-miR-3619-5p	CLIP-seq
MIRT1233023	hsa-miR-4270	CLIP-seq
MIRT1233024	hsa-miR-4441	CLIP-seq
MIRT1233025	hsa-miR-4530	CLIP-seq
MIRT1233026	hsa-miR-4650-5p	CLIP-seq
MIRT1233027	hsa-miR-4690-5p	CLIP-seq
MIRT1233028	hsa-miR-4739	CLIP-seq
MIRT1233029	hsa-miR-4756-5p	CLIP-seq
MIRT1233030	hsa-miR-491-3p	CLIP-seq
MIRT1233031	hsa-miR-650	CLIP-seq
MIRT1233032	hsa-miR-761	CLIP-seq
MIRT1233033	hsa-miR-940	CLIP-seq
MIRT2068590	hsa-miR-34a	CLIP-seq
MIRT2068591	hsa-miR-34c-5p	CLIP-seq
MIRT2068592	hsa-miR-4302	CLIP-seq
MIRT2068593	hsa-miR-449a	CLIP-seq
MIRT2068594	hsa-miR-449b	CLIP-seq
MIRT2068595	hsa-miR-486-3p	CLIP-seq
MIRT2392503	hsa-miR-532-3p	CLIP-seq
MIRT2593534	hsa-miR-124	CLIP-seq
MIRT2593535	hsa-miR-3667-3p	CLIP-seq
MIRT2593536	hsa-miR-3691-3p	CLIP-seq
MIRT2593537	hsa-miR-3714	CLIP-seq
MIRT2593538	hsa-miR-3910	CLIP-seq
MIRT2593539	hsa-miR-4469	CLIP-seq
MIRT2593540	hsa-miR-4715-3p	CLIP-seq
MIRT2593541	hsa-miR-4736	CLIP-seq
MIRT2593542	hsa-miR-506	CLIP-seq
MIRT2593543	hsa-miR-642a	CLIP-seq
MIRT1233033	hsa-miR-940	CLIP-seq

Show/Hide all(54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	ISS
GO:0002092	Process	Positive regulation of receptor internalization	IBA
GO:0002092	Process	Positive regulation of receptor internalization	ISS
GO:0003779	Function	Actin binding	IEA
GO:0005080	Function	Protein kinase C binding	IBA
GO:0005080	Function	Protein kinase C binding	ISS
GO:0005102	Function	Signaling receptor binding	ISS
GO:0005515	Function	Protein binding	IPI	11343649, 11802773, 16314870, 16713569, 21653829, 28514442, 31413325, 32296183, 32814053, 33961781, 37207277
GO:0005543	Function	Phospholipid binding	IBA
GO:0005737	Component	Cytoplasm	IDA	11343649, 16314870
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	11343649
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	ISS
GO:0006886	Process	Intracellular protein transport	IBA
GO:0008021	Component	Synaptic vesicle	IBA
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0015844	Process	Monoamine transport	IDA	11343649
GO:0016020	Component	Membrane	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0019904	Function	Protein domain specific binding	ISS
GO:0021782	Process	Glial cell development	ISS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0032588	Component	Trans-Golgi network membrane	IBA
GO:0034315	Process	Regulation of Arp2/3 complex-mediated actin nucleation	IBA
GO:0034316	Process	Negative regulation of Arp2/3 complex-mediated actin nucleation	ISS
GO:0036294	Process	Cellular response to decreased oxygen levels	ISS
GO:0042149	Process	Cellular response to glucose starvation	ISS
GO:0042734	Component	Presynaptic membrane	IDA	11343649
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042802	Function	Identical protein binding	ISS
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043113	Process	Receptor clustering	IBA
GO:0043113	Process	Receptor clustering	ISS
GO:0045161	Process	Neuronal ion channel clustering	TAS	11343649
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0050796	Process	Regulation of insulin secretion	IMP	29768204
GO:0051015	Function	Actin filament binding	ISS
GO:0060292	Process	Long-term synaptic depression	ISS
GO:0071933	Function	Arp2/3 complex binding	ISS
GO:0097061	Process	Dendritic spine organization	ISS
GO:0097062	Process	Dendritic spine maintenance	IBA
GO:0097062	Process	Dendritic spine maintenance	ISS
GO:0140090	Function	Membrane curvature sensor activity	IDA	29768204

MIM	HGNC	e!Ensembl
605926	9394	ENSG00000100151

Protein

UniProt ID

Q9NRD5

Protein name

PRKCA-binding protein (Protein interacting with C kinase 1) (Protein kinase C-alpha-binding protein)

Protein function

Probable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor inter

PDB

2GZV , 6AR4 , 6BJN , 6BJO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00595	PDZ	22 → 102	PDZ domain	Domain
PF06456	Arfaptin	117 → 352	Arfaptin-like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI
EVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS

Sequence length

415

Interactions

View interactions

	Reactome
			Trafficking of GluR2-containing AMPA receptors

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Male infertility	male infertility due to globozoospermia	N/A	N/A	GenCC

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arteriovenous Malformations	Associate	36718590
Astrocytoma	Inhibit	26466675
Blindness	Associate	33877510
Carcinogenesis	Associate	26466675
Diabetes Mellitus	Associate	35077398
Infections	Associate	31740529
Neuralgia	Associate	32352640
Stomach Neoplasms	Associate	31886120
Teratozoospermia	Associate	20562896, 21397063

PICK1 (protein interacting with PRKCA 1)