HOMER3 (homer scaffold protein 3)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9454
Gene name Gene Name - the full gene name approved by the HGNC.
Homer scaffold protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOMER3
Synonyms (NCBI Gene) Gene synonyms aliases
HOMER-3, VESL3
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the HOMER family of postsynaptic density scaffolding proteins that share a similar domain structure consisting of an N-terminal Enabled/vasodilator-stimulated phosphoprotein homology 1 domain which mediates protein-protein in
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT1052599 hsa-miR-1538 CLIP-seq
MIRT1052600 hsa-miR-1915 CLIP-seq
MIRT1052601 hsa-miR-3940-3p CLIP-seq
MIRT1052602 hsa-miR-4685-5p CLIP-seq
MIRT1052603 hsa-miR-4690-3p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
CEBPA Unknown 14645007
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 16979624, 18218901, 18387811, 19060904, 19345194, 21516116, 21911467, 25416956, 25910212, 26871637, 29892012, 32296183
GO:0005575 Component Cellular_component ND
GO:0005737 Component Cytoplasm IBA 21873635
GO:0005829 Component Cytosol TAS
GO:0005886 Component Plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604800 17514 ENSG00000051128
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9NSC5
Protein name Homer protein homolog 3 (Homer-3)
Protein function Postsynaptic density scaffolding protein. Binds and cross-links cytoplasmic regions of GRM1, GRM5, ITPR1, DNM3, RYR1, RYR2, SHANK1 and SHANK3. By physically linking GRM1 and GRM5 with ER-associated ITPR1 receptors, it aids the coupling of surfac
PDB 2P8V , 3CVF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00568 WH1 1 → 110 WH1 domain Domain
Sequence 
MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALGLASHQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSV
GEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAAS
EVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQDL
ETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAA
P
Sequence length 361
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  FoxO signaling pathway
Glutamatergic synapse 		  Neurexins and neuroligins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenoid Cystic Carcinoma rs121913530, rs886039394, rs121913474 16762588
Show/Hide Text Mining Associations (11)
Associations from Text Mining
Disease Name Relationship Type References
Depressive Disorder Major Associate 37511534
Glioma Associate 33885248
Hypoxia Associate 34108014
Keratoconus Associate 39238827
Leukemia Associate 23725168
Leukemia Myeloid Acute Associate 23725168
Mood Disorders Associate 37511534
Neoplasm Metastasis Associate 34108014
Neoplasms Associate 34108014
Precursor T Cell Lymphoblastic Leukemia Lymphoma Associate 37820824