Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
943
Gene name Gene Name - the full gene name approved by the HGNC.
TNF receptor superfamily member 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFRSF8
Synonyms (NCBI Gene) Gene synonyms aliases
CD30, D1S166E, Ki-1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.22
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to th
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT719567 hsa-miR-4738-5p HITS-CLIP 19536157
MIRT719566 hsa-miR-600 HITS-CLIP 19536157
MIRT719565 hsa-miR-4297 HITS-CLIP 19536157
MIRT719564 hsa-miR-5581-5p HITS-CLIP 19536157
MIRT719563 hsa-miR-6512-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002020 Function Protease binding IPI 12777399
GO:0004888 Function Transmembrane signaling receptor activity IEA
GO:0004888 Function Transmembrane signaling receptor activity TAS 1310894
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
153243 11923 ENSG00000120949
Protein
UniProt ID P28908
Protein name Tumor necrosis factor receptor superfamily member 8 (CD30L receptor) (Ki-1 antigen) (Lymphocyte activation antigen CD30) (CD antigen CD30)
Protein function Receptor for TNFSF8/CD30L (PubMed:8391931). May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B (PubMed:8999898). {ECO:0000269|PubMed:83919
PDB 1D01
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 108 149 TNFR/NGFR cysteine-rich region Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 2]: Detected in alveolar macrophages (at protein level). {ECO:0000269|PubMed:8839832}.
Sequence
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ
RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN
SCARCFFHSVCPAGMIVKFPGTAQKNTVC
EPASPGVSPACASPENCKEPSSGTIPQAKPT
PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC
RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC
VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA
SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL
HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL
ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL
AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Sequence length 595
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Atopic asthma, Asthma N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Associate 16200333
Acquired Immunodeficiency Syndrome Associate 11699717
Acute Disease Associate 22661699
Airway Remodeling Associate 35579040
alpha Thalassemia Associate 32482310
Alveolar echinococcosis Associate 9933429
Alzheimer Disease Associate 31666081
Amyloidosis Primary Cutaneous Associate 10556192, 12648233, 31640798
Angioedemas Hereditary Associate 15050749
Anodontia Associate 8896393