TNFRSF8 (TNF receptor superfamily member 8)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
943
Gene name Gene Name - the full gene name approved by the HGNC.
TNF receptor superfamily member 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFRSF8
Synonyms (NCBI Gene) Gene synonyms aliases
CD30, D1S166E, Ki-1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.22
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to th
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(99)
miRTarBase ID miRNA Experiments Reference
MIRT719567 hsa-miR-4738-5p HITS-CLIP 19536157
MIRT719566 hsa-miR-600 HITS-CLIP 19536157
MIRT719565 hsa-miR-4297 HITS-CLIP 19536157
MIRT719564 hsa-miR-5581-5p HITS-CLIP 19536157
MIRT719563 hsa-miR-6512-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IEA
GO:0005737 Component Cytoplasm IEA
GO:0005886 Component Plasma membrane IDA
GO:0005886 Component Plasma membrane TAS
GO:0007165 Process Signal transduction TAS 10192335
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
153243 11923 ENSG00000120949
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P28908
Protein name Tumor necrosis factor receptor superfamily member 8 (CD30L receptor) (Ki-1 antigen) (Lymphocyte activation antigen CD30) (CD antigen CD30)
Protein function Receptor for TNFSF8/CD30L (PubMed:8391931). May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B (PubMed:8999898). {ECO:0000269|PubMed:83919
PDB 1D01
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 108 → 149 TNFR/NGFR cysteine-rich region Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 2]: Detected in alveolar macrophages (at protein level). {ECO:0000269|PubMed:8839832}.
Sequence 
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ
RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN
SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT
PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC
RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC
VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA
SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL
HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL
ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL
AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Sequence length 595
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Hodgkin lymphoma Adult Hodgkin Lymphoma 16879607, 12453859 ClinVar
Eczema Eczema GWAS
Asthma Asthma GWAS
Show/Hide Text Mining Associations (216)
Associations from Text Mining
Disease Name Relationship Type References
Abortion Habitual Associate 16200333
Acquired Immunodeficiency Syndrome Associate 11699717
Acute Disease Associate 22661699
Airway Remodeling Associate 35579040
alpha Thalassemia Associate 32482310
Alveolar echinococcosis Associate 9933429
Alzheimer Disease Associate 31666081
Amyloidosis Primary Cutaneous Associate 10556192, 12648233, 31640798
Angioedemas Hereditary Associate 15050749
Anodontia Associate 8896393