OPN4 (opsin 4)

Gene

• Entrez ID: 94233
• Gene name: Opsin 4
• Gene symbol: OPN4
• Synonyms (NCBI Gene): MOP
• Chromosome: 10
• Chromosome location: 10q23.2
• Summary: Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. This gene encodes a photoreceptive opsin protein that is expressed within the ganglion and amacrine cell layers of the retina. In mouse, retinal ganglio

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2058988	hsa-miR-185	CLIP-seq
MIRT2058989	hsa-miR-3184	CLIP-seq
MIRT2058990	hsa-miR-3675-5p	CLIP-seq
MIRT2058991	hsa-miR-423-5p	CLIP-seq
MIRT2058992	hsa-miR-4306	CLIP-seq
MIRT2058993	hsa-miR-4644	CLIP-seq
MIRT2585299	hsa-miR-3166	CLIP-seq
MIRT2585300	hsa-miR-3689a-3p	CLIP-seq
MIRT2585301	hsa-miR-3689c	CLIP-seq
MIRT2585302	hsa-miR-4728-5p	CLIP-seq
MIRT2585303	hsa-miR-4795-5p	CLIP-seq
MIRT2585304	hsa-miR-549	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005502	Function	11-cis retinal binding	IDA	15674244
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	31380578, 31730232
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007601	Process	Visual perception	IEA
GO:0007602	Process	Phototransduction	IBA
GO:0007602	Process	Phototransduction	IDA	15674244
GO:0007602	Process	Phototransduction	IEA
GO:0007634	Process	Optokinetic behavior	IEA
GO:0007634	Process	Optokinetic behavior	ISS
GO:0008020	Function	G protein-coupled photoreceptor activity	IBA
GO:0008020	Function	G protein-coupled photoreceptor activity	IDA	15674244
GO:0008020	Function	G protein-coupled photoreceptor activity	IEA
GO:0009584	Process	Detection of visible light	IEA
GO:0009881	Function	Photoreceptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10632589
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0042752	Process	Regulation of circadian rhythm	IBA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043052	Process	Thermotaxis	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050960	Process	Detection of temperature stimulus involved in thermoception	IEA
GO:0060041	Process	Retina development in camera-type eye	IEA
GO:0071482	Process	Cellular response to light stimulus	IBA
GO:0097381	Component	Photoreceptor disc membrane	IEA
GO:0097381	Component	Photoreceptor disc membrane	TAS
GO:1990384	Process	Hyaloid vascular plexus regression	IEA
GO:1990384	Process	Hyaloid vascular plexus regression	ISS
GO:1990913	Component	Sperm head plasma membrane	IEA

Other IDs

• MIM: 606665
• HGNC: 14449
• e!Ensembl: ENSG00000122375

Protein

• UniProt ID: Q9UHM6
• Protein name: Melanopsin (Opsin-4)
• Protein function: Photoreceptor that binds cis-retinaldehydes (PubMed:15674244). Contributes to pupillar reflex, photoentrainment and other non-image forming responses to light (By similarity). May be involved in the optokinetic visual tracking response (By simil
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	87 → 350	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the retina. {ECO:0000269|PubMed:10632589}.
• Sequence:

  MNPPSGPRVPPSPTQEPSCMATPAPPSWWDSSQSSISSLGRLPSISPTAPGTWAAAWVPL
  PTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMS
  FTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFG
  VASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLC
  CFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLL
  VILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVA
  IAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGW
  THMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM

• Sequence length: 478

Pathways

Reactome:

G alpha (q) signalling events
Opsins

<