Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	94233
Gene name Gene Name - the full gene name approved by the HGNC.	Opsin 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OPN4
Synonyms (NCBI Gene) Gene synonyms aliases	MOP
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q23.2
Summary Summary of gene provided in NCBI Entrez Gene.	Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. This gene encodes a photoreceptive opsin protein that is expressed within the ganglion and amacrine cell layers of the retina. In mouse, retinal ganglio

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments
MIRT2058988	hsa-miR-185	CLIP-seq
MIRT2058989	hsa-miR-3184	CLIP-seq
MIRT2058990	hsa-miR-3675-5p	CLIP-seq
MIRT2058991	hsa-miR-423-5p	CLIP-seq
MIRT2058992	hsa-miR-4306	CLIP-seq
MIRT2058993	hsa-miR-4644	CLIP-seq
MIRT2585299	hsa-miR-3166	CLIP-seq
MIRT2585300	hsa-miR-3689a-3p	CLIP-seq
MIRT2585301	hsa-miR-3689c	CLIP-seq
MIRT2585302	hsa-miR-4728-5p	CLIP-seq
MIRT2585303	hsa-miR-4795-5p	CLIP-seq
MIRT2585304	hsa-miR-549	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005502	Function	11-cis retinal binding	IDA	15674244
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IDA	31380578, 31730232
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007601	Process	Visual perception	IEA
GO:0007602	Process	Phototransduction	IBA	21873635
GO:0007602	Process	Phototransduction	IDA	15674244
GO:0007634	Process	Optokinetic behavior	ISS
GO:0008020	Function	G protein-coupled photoreceptor activity	IBA	21873635
GO:0008020	Function	G protein-coupled photoreceptor activity	IDA	15674244
GO:0009584	Process	Detection of visible light	IEA
GO:0016021	Component	Integral component of membrane	TAS	10632589
GO:0018298	Process	Protein-chromophore linkage	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043204	Component	Perikaryon	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0071482	Process	Cellular response to light stimulus	IBA	21873635
GO:0097381	Component	Photoreceptor disc membrane	TAS
GO:1990384	Process	Hyaloid vascular plexus regression	ISS

MIM	HGNC	e!Ensembl
606665	14449	ENSG00000122375

Protein

UniProt ID

Q9UHM6

Protein name

Melanopsin (Opsin-4)

Protein function

Photoreceptor that binds cis-retinaldehydes (PubMed:15674244). Contributes to pupillar reflex, photoentrainment and other non-image forming responses to light (By similarity). May be involved in the optokinetic visual tracking response (By simil

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	87 → 350	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the retina. {ECO:0000269|PubMed:10632589}.

Sequence

MNPPSGPRVPPSPTQEPSCMATPAPPSWWDSSQSSISSLGRLPSISPTAPGTWAAAWVPL
PTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMS
FTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFG
VASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLC
CFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLL
VILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVA
IAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGW
THMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM

Sequence length

478

Interactions

View interactions

	Reactome
			G alpha (q) signalling events Opsins

OPN4 (opsin 4)