Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	941
Gene name	CD80 molecule
Gene symbol	CD80
Synonyms (NCBI Gene)	B7B7-1B7.1BB1CD28LGCD28LG1LAB7
Chromosome	3
Chromosome location	3q13.33
Summary	The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may pl

Show/Hide all (34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021278	hsa-miR-146a-5p	Other	20375304
MIRT021278	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26505653
MIRT021278	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26505653
MIRT876186	hsa-let-7a	CLIP-seq
MIRT876187	hsa-let-7b	CLIP-seq
MIRT876188	hsa-let-7c	CLIP-seq
MIRT876189	hsa-let-7d	CLIP-seq
MIRT876190	hsa-let-7e	CLIP-seq
MIRT876191	hsa-let-7f	CLIP-seq
MIRT876192	hsa-let-7g	CLIP-seq
MIRT876193	hsa-let-7i	CLIP-seq
MIRT876194	hsa-miR-103a	CLIP-seq
MIRT876195	hsa-miR-107	CLIP-seq
MIRT876196	hsa-miR-1294	CLIP-seq
MIRT876197	hsa-miR-15a	CLIP-seq
MIRT876198	hsa-miR-15b	CLIP-seq
MIRT876199	hsa-miR-16	CLIP-seq
MIRT876200	hsa-miR-195	CLIP-seq
MIRT876201	hsa-miR-202	CLIP-seq
MIRT876202	hsa-miR-3148	CLIP-seq
MIRT876203	hsa-miR-3174	CLIP-seq
MIRT876204	hsa-miR-3611	CLIP-seq
MIRT876205	hsa-miR-3688-3p	CLIP-seq
MIRT876206	hsa-miR-424	CLIP-seq
MIRT876207	hsa-miR-4458	CLIP-seq
MIRT876208	hsa-miR-4464	CLIP-seq
MIRT876209	hsa-miR-4500	CLIP-seq
MIRT876210	hsa-miR-4694-3p	CLIP-seq
MIRT876211	hsa-miR-4748	CLIP-seq
MIRT876212	hsa-miR-497	CLIP-seq
MIRT876213	hsa-miR-522	CLIP-seq
MIRT876214	hsa-miR-758	CLIP-seq
MIRT876215	hsa-miR-921	CLIP-seq
MIRT876216	hsa-miR-98	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
BCL6	Repression	12860928
IRF7	Activation	16237059
NFKB1	Activation	11359799;12860928
RELA	Activation	11359799;12860928
TRERF1	Repression	18652845

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002682	Process	Regulation of immune system process	IEA
GO:0002710	Process	Negative regulation of T cell mediated immunity	IDA	11015443
GO:0005515	Function	Protein binding	IPI	9915850, 11279502, 18585785, 20587542, 21982860, 23417675, 31000591
GO:0005886	Component	Plasma membrane	IC	11279502, 24845157
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	1370389
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009967	Process	Positive regulation of signal transduction	NAS	9915850
GO:0009986	Component	Cell surface	HDA	23981064
GO:0015026	Function	Coreceptor activity	IEA
GO:0015026	Function	Coreceptor activity	NAS	9915850
GO:0016020	Component	Membrane	IEA
GO:0031295	Process	T cell costimulation	IBA
GO:0031295	Process	T cell costimulation	IDA	8484124
GO:0031295	Process	T cell costimulation	IEA
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	NAS	9915850
GO:0032743	Process	Positive regulation of interleukin-2 production	NAS	9915850
GO:0035556	Process	Intracellular signal transduction	NAS	9915850
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0042110	Process	T cell activation	IDA	7568038, 7737275, 23918985
GO:0042110	Process	T cell activation	IDA	23918985
GO:0042130	Process	Negative regulation of T cell proliferation	IBA
GO:0045627	Process	Positive regulation of T-helper 1 cell differentiation	NAS	9915850
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	9915850
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0048018	Function	Receptor ligand activity	IDA	24845157
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	9915850
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0098636	Component	Protein complex involved in cell adhesion	IDA	7544393

MIM	HGNC	e!Ensembl
112203	1700	ENSG00000121594

P33681

Protein name

T-lymphocyte activation antigen CD80 (Activation B7-1 antigen) (BB1) (CTLA-4 counter-receptor B7.1) (B7) (CD antigen CD80)

Protein function

Costimulatory molecule that belongs to the immunoglobulin superfamily that plays an important role in T-lymphocyte activation (PubMed:38467718). Acts as the primary auxiliary signal augmenting the MHC/TCR signal in naive T-cells together with th

PDB

1DR9 , 1I8L , 7TPS , 8FXW , 8FXZ , 8HXA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	36 → 135	Immunoglobulin V-set domain	Domain
PF08205	C2-set_2	141 → 227	CD80-like C2-set immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed on activated B-cells, macrophages and dendritic cells.

Sequence

MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELA
QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK
YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE
ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP
DNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV

Sequence length

288

Interactions

View interactions

	KEGG		Reactome
	Virion - Adenovirus Cell adhesion molecules Toll-like receptor signaling pathway Intestinal immune network for IgA production Type I diabetes mellitus Autoimmune thyroid disease Systemic lupus erythematosus Rheumatoid arthritis Allograft rejection Graft-versus-host disease Viral myocarditis		PIP3 activates AKT signaling Constitutive Signaling by Aberrant PI3K in Cancer CD28 co-stimulation CD28 dependent PI3K/Akt signaling CD28 dependent Vav1 pathway CTLA4 inhibitory signaling Interleukin-10 signaling PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

CD80 (CD80 molecule)