Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9404
Gene name Gene Name - the full gene name approved by the HGNC.	Leupaxin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LPXN
Synonyms (NCBI Gene) Gene synonyms aliases	LDPL
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q12.1
Summary Summary of gene provided in NCBI Entrez Gene.	The product encoded by this gene is preferentially expressed in hematopoietic cells and belongs to the paxillin protein family. Similar to other members of this focal-adhesion-associated adaptor-protein family, it has four leucine-rich LD-motifs in the N-

Show/Hide all(22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021415	hsa-miR-9-5p	Microarray	17612493
MIRT644474	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT644473	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT644472	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT644471	hsa-miR-4635	HITS-CLIP	23824327
MIRT644470	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT644469	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT644468	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT644474	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT644473	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT644472	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT644471	hsa-miR-4635	HITS-CLIP	23824327
MIRT644470	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT644469	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT644468	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT1117171	hsa-miR-34c-3p	CLIP-seq
MIRT1117172	hsa-miR-3647-3p	CLIP-seq
MIRT1117173	hsa-miR-4434	CLIP-seq
MIRT1117174	hsa-miR-4516	CLIP-seq
MIRT1117175	hsa-miR-4529-5p	CLIP-seq
MIRT1117176	hsa-miR-4531	CLIP-seq
MIRT1117177	hsa-miR-4694-3p	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002102	Component	Podosome	IDA	12674328
GO:0003712	Function	Transcription coregulator activity	IBA	21873635
GO:0003712	Function	Transcription coregulator activity	IDA	18451096, 18497331
GO:0005515	Function	Protein binding	IPI	17640867, 18451096, 18497331, 23088713, 25416956, 28514442, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	18451096, 18497331
GO:0005737	Component	Cytoplasm	IDA	17640867, 18451096, 18497331
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	17640867
GO:0005925	Component	Focal adhesion	IBA	21873635
GO:0005925	Component	Focal adhesion	IDA	18451096, 18497331, 20543562
GO:0006355	Process	Regulation of transcription, DNA-templated	IEA
GO:0007155	Process	Cell adhesion	NAS	9565592
GO:0007162	Process	Negative regulation of cell adhesion	IDA	20543562
GO:0007165	Process	Signal transduction	TAS	9565592
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA	21873635
GO:0016020	Component	Membrane	HDA	19946888
GO:0016607	Component	Nuclear speck	IDA
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IBA	21873635
GO:0042995	Component	Cell projection	IEA
GO:0043542	Process	Endothelial cell migration	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IBA	21873635
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IDA	17640867
GO:0065003	Process	Protein-containing complex assembly	TAS	9565592

MIM	HGNC	e!Ensembl
605390	14061	ENSG00000110031

Protein

UniProt ID

O60711

Protein name

Leupaxin

Protein function

Transcriptional coactivator for androgen receptor (AR) and serum response factor (SRF). Contributes to the regulation of cell adhesion, spreading and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events. Supp

PDB

1X3H , 4XEF , 4XEK , 4XEV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00412	LIM	152 → 207	LIM domain	Domain
PF00412	LIM	211 → 266	LIM domain	Domain
PF00412	LIM	270 → 325	LIM domain	Domain
PF00412	LIM	329 → 384	LIM domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Macrophages, monocytes and osteoclasts (at protein level). Strongly expressed in cells and tissues of hematopoietic origin. Highest expression in lymphoid tissues such as spleen, lymph node, thymus and appendix and in the vascular smoo

Sequence

MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQL
VYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPD
KQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTH
CKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHC
GEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLT
QLSKGIFREQNDKTYCQPCFNKLFPL

Sequence length

386

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	23128233

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Inflammatory Bowel Disease	Inflammatory Bowel Disease	GWAS
Ulcerative colitis	Ulcerative colitis	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	26866573
Carcinoma Hepatocellular	Associate	26361959
Endometrial Neoplasms	Associate	34763648
Lymphoma	Associate	23349640
Lymphoma Large B Cell Diffuse	Associate	32219808
Neoplasm Metastasis	Associate	29975926
Neoplasms	Associate	29975926, 32859368
Periodontitis	Associate	34732256
Prostatic Neoplasms	Associate	17329398, 18451096, 26079947
Prostatitis	Associate	18451096
Urinary Bladder Neoplasms	Stimulate	29975926

LPXN (leupaxin)