LPXN (leupaxin)

Gene

• Entrez ID: 9404
• Gene name: Leupaxin
• Gene symbol: LPXN
• Synonyms (NCBI Gene): LDPL
• Chromosome: 11
• Chromosome location: 11q12.1
• Summary: The product encoded by this gene is preferentially expressed in hematopoietic cells and belongs to the paxillin protein family. Similar to other members of this focal-adhesion-associated adaptor-protein family, it has four leucine-rich LD-motifs in the N-

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021415	hsa-miR-9-5p	Microarray	17612493
MIRT644474	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT644473	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT644472	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT644471	hsa-miR-4635	HITS-CLIP	23824327
MIRT644470	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT644469	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT644468	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT644474	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT644473	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT644472	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT644471	hsa-miR-4635	HITS-CLIP	23824327
MIRT644470	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT644469	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT644468	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT1117171	hsa-miR-34c-3p	CLIP-seq
MIRT1117172	hsa-miR-3647-3p	CLIP-seq
MIRT1117173	hsa-miR-4434	CLIP-seq
MIRT1117174	hsa-miR-4516	CLIP-seq
MIRT1117175	hsa-miR-4529-5p	CLIP-seq
MIRT1117176	hsa-miR-4531	CLIP-seq
MIRT1117177	hsa-miR-4694-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002102	Component	Podosome	IDA	12674328
GO:0002102	Component	Podosome	IEA
GO:0003712	Function	Transcription coregulator activity	IDA	18451096, 18497331
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0005515	Function	Protein binding	IPI	17640867, 18451096, 18497331, 21900206, 23088713, 25416956, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	18451096, 18497331
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	17640867, 18451096, 18497331
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	17640867
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IDA	18451096, 18497331, 20543562
GO:0005925	Component	Focal adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	NAS	9565592
GO:0007162	Process	Negative regulation of cell adhesion	IDA	20543562
GO:0007165	Process	Signal transduction	TAS	9565592
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043542	Process	Endothelial cell migration	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IBA
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IDA	17640867
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IEA
GO:0065003	Process	Protein-containing complex assembly	TAS	9565592
GO:0070161	Component	Anchoring junction	IEA

Other IDs

• MIM: 605390
• HGNC: 14061
• e!Ensembl: ENSG00000110031

Protein

• UniProt ID: O60711
• Protein name: Leupaxin
• Protein function: Transcriptional coactivator for androgen receptor (AR) and serum response factor (SRF). Contributes to the regulation of cell adhesion, spreading and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events. Supp
• PDB: 1X3H, 4XEF, 4XEK, 4XEV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	152 → 207	LIM domain	Domain
  PF00412	LIM	211 → 266	LIM domain	Domain
  PF00412	LIM	270 → 325	LIM domain	Domain
  PF00412	LIM	329 → 384	LIM domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Macrophages, monocytes and osteoclasts (at protein level). Strongly expressed in cells and tissues of hematopoietic origin. Highest expression in lymphoid tissues such as spleen, lymph node, thymus and appendix and in the vascular smoo
• Sequence:

  MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQL
  VYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPD
  KQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTH
  CKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHC
  GEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
  TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLT
  QLSKGIFREQNDKTYCQPCFNKLFPL

• Sequence length: 386