Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	940
Gene name Gene Name - the full gene name approved by the HGNC.	CD28 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD28
Synonyms (NCBI Gene) Gene synonyms aliases	IMD123, Tp44
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q33.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provide

Show/Hide all(235)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029645	hsa-miR-26b-5p	Microarray	19088304
MIRT438542	hsa-miR-145-5p	Luciferase reporter assay	24043548
MIRT438542	hsa-miR-145-5p	Luciferase reporter assay	24043548
MIRT684938	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT684937	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT684936	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT684935	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT684934	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT684933	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT684932	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT684931	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT684930	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT684929	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT684928	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT684927	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT684926	hsa-miR-302e	HITS-CLIP	23313552
MIRT684925	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT684924	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT684923	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT684922	hsa-miR-520b	HITS-CLIP	23313552
MIRT684921	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT684920	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT684919	hsa-miR-520e	HITS-CLIP	23313552
MIRT684918	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684917	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT684916	hsa-miR-520h	HITS-CLIP	23313552
MIRT684915	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT684914	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT684913	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684912	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684910	hsa-miR-4252	HITS-CLIP	23313552
MIRT684911	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684909	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684908	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT684907	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT620147	hsa-miR-5586-3p	HITS-CLIP	23824327
MIRT669127	hsa-miR-6753-3p	HITS-CLIP	23824327
MIRT669126	hsa-miR-7107-3p	HITS-CLIP	23824327
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT620145	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT659689	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT659688	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT659687	hsa-miR-4287	HITS-CLIP	23824327
MIRT659686	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT659685	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT659684	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT659683	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT620145	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT620147	hsa-miR-5586-3p	HITS-CLIP	23824327
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT620145	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT620147	hsa-miR-5586-3p	HITS-CLIP	23824327
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT620145	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT620145	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT620145	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT620145	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT620145	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT669127	hsa-miR-6753-3p	HITS-CLIP	27418678
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT669126	hsa-miR-7107-3p	HITS-CLIP	27418678
MIRT684938	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT684937	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT684936	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT684935	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT684934	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT684933	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT684932	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT684931	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT684930	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT684929	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT684928	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT684927	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT684926	hsa-miR-302e	HITS-CLIP	23313552
MIRT684925	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT684924	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT684923	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT684922	hsa-miR-520b	HITS-CLIP	23313552
MIRT684921	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT684920	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT684919	hsa-miR-520e	HITS-CLIP	23313552
MIRT684918	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684917	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT684916	hsa-miR-520h	HITS-CLIP	23313552
MIRT684915	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT684914	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT684913	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684912	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684910	hsa-miR-4252	HITS-CLIP	23313552
MIRT684911	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684909	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684908	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT684907	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT620147	hsa-miR-5586-3p	HITS-CLIP	23824327
MIRT669127	hsa-miR-6753-3p	HITS-CLIP	23824327
MIRT669126	hsa-miR-7107-3p	HITS-CLIP	23824327
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT620145	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT659689	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT659688	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT659687	hsa-miR-4287	HITS-CLIP	23824327
MIRT659686	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT659685	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT659684	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT659683	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT620145	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT620147	hsa-miR-5586-3p	HITS-CLIP	23824327
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT620145	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT620147	hsa-miR-5586-3p	HITS-CLIP	23824327
MIRT620146	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT620145	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT874585	hsa-miR-106a	CLIP-seq
MIRT874586	hsa-miR-106b	CLIP-seq
MIRT874587	hsa-miR-1224-3p	CLIP-seq
MIRT874588	hsa-miR-1234	CLIP-seq
MIRT874589	hsa-miR-1245	CLIP-seq
MIRT874590	hsa-miR-1273e	CLIP-seq
MIRT874591	hsa-miR-1273f	CLIP-seq
MIRT874592	hsa-miR-1289	CLIP-seq
MIRT874593	hsa-miR-1305	CLIP-seq
MIRT874594	hsa-miR-143	CLIP-seq
MIRT874595	hsa-miR-150	CLIP-seq
MIRT874596	hsa-miR-17	CLIP-seq
MIRT874597	hsa-miR-185	CLIP-seq
MIRT874598	hsa-miR-1913	CLIP-seq
MIRT874599	hsa-miR-20a	CLIP-seq
MIRT874600	hsa-miR-20b	CLIP-seq
MIRT874601	hsa-miR-302a	CLIP-seq
MIRT874602	hsa-miR-302b	CLIP-seq
MIRT874603	hsa-miR-302c	CLIP-seq
MIRT874604	hsa-miR-302d	CLIP-seq
MIRT874605	hsa-miR-3135b	CLIP-seq
MIRT874606	hsa-miR-3136-5p	CLIP-seq
MIRT874607	hsa-miR-3198	CLIP-seq
MIRT874608	hsa-miR-324-3p	CLIP-seq
MIRT874609	hsa-miR-3652	CLIP-seq
MIRT874610	hsa-miR-3664-5p	CLIP-seq
MIRT874611	hsa-miR-3671	CLIP-seq
MIRT874612	hsa-miR-3691-3p	CLIP-seq
MIRT874613	hsa-miR-372	CLIP-seq
MIRT874614	hsa-miR-373	CLIP-seq
MIRT874615	hsa-miR-3925-3p	CLIP-seq
MIRT874616	hsa-miR-3944-5p	CLIP-seq
MIRT874617	hsa-miR-4267	CLIP-seq
MIRT874618	hsa-miR-4294	CLIP-seq
MIRT874619	hsa-miR-4306	CLIP-seq
MIRT874620	hsa-miR-4309	CLIP-seq
MIRT874621	hsa-miR-4430	CLIP-seq
MIRT874622	hsa-miR-4439	CLIP-seq
MIRT874623	hsa-miR-4513	CLIP-seq
MIRT874624	hsa-miR-4534	CLIP-seq
MIRT874625	hsa-miR-4639-3p	CLIP-seq
MIRT874626	hsa-miR-4644	CLIP-seq
MIRT874627	hsa-miR-4695-3p	CLIP-seq
MIRT874628	hsa-miR-4708-5p	CLIP-seq
MIRT874629	hsa-miR-4770	CLIP-seq
MIRT874630	hsa-miR-513c	CLIP-seq
MIRT874631	hsa-miR-514b-5p	CLIP-seq
MIRT874632	hsa-miR-519d	CLIP-seq
MIRT874633	hsa-miR-520g	CLIP-seq
MIRT874634	hsa-miR-576-3p	CLIP-seq
MIRT874635	hsa-miR-607	CLIP-seq
MIRT874636	hsa-miR-616	CLIP-seq
MIRT874637	hsa-miR-766	CLIP-seq
MIRT874638	hsa-miR-93	CLIP-seq
MIRT874639	hsa-miR-943	CLIP-seq
MIRT1959284	hsa-miR-27a	CLIP-seq
MIRT1959285	hsa-miR-27b	CLIP-seq
MIRT1959286	hsa-miR-4659a-3p	CLIP-seq
MIRT1959287	hsa-miR-4659b-3p	CLIP-seq
MIRT1959288	hsa-miR-4753-3p	CLIP-seq
MIRT1959289	hsa-miR-498	CLIP-seq
MIRT1959290	hsa-miR-513a-5p	CLIP-seq
MIRT874591	hsa-miR-1273f	CLIP-seq
MIRT2196312	hsa-miR-1278	CLIP-seq
MIRT874592	hsa-miR-1289	CLIP-seq
MIRT874594	hsa-miR-143	CLIP-seq
MIRT2196313	hsa-miR-155	CLIP-seq
MIRT874597	hsa-miR-185	CLIP-seq
MIRT2196314	hsa-miR-219-5p	CLIP-seq
MIRT874605	hsa-miR-3135b	CLIP-seq
MIRT874607	hsa-miR-3198	CLIP-seq
MIRT874609	hsa-miR-3652	CLIP-seq
MIRT874610	hsa-miR-3664-5p	CLIP-seq
MIRT874618	hsa-miR-4294	CLIP-seq
MIRT874619	hsa-miR-4306	CLIP-seq
MIRT874620	hsa-miR-4309	CLIP-seq
MIRT874621	hsa-miR-4430	CLIP-seq
MIRT874624	hsa-miR-4534	CLIP-seq
MIRT874625	hsa-miR-4639-3p	CLIP-seq
MIRT874626	hsa-miR-4644	CLIP-seq
MIRT874628	hsa-miR-4708-5p	CLIP-seq
MIRT874629	hsa-miR-4770	CLIP-seq
MIRT2196315	hsa-miR-4782-3p	CLIP-seq
MIRT2196316	hsa-miR-4794	CLIP-seq
MIRT1959289	hsa-miR-498	CLIP-seq
MIRT2385729	hsa-miR-1270	CLIP-seq
MIRT874591	hsa-miR-1273f	CLIP-seq
MIRT874605	hsa-miR-3135b	CLIP-seq
MIRT874609	hsa-miR-3652	CLIP-seq
MIRT874621	hsa-miR-4430	CLIP-seq
MIRT2385730	hsa-miR-4683	CLIP-seq
MIRT2385731	hsa-miR-4743	CLIP-seq
MIRT2385732	hsa-miR-620	CLIP-seq
MIRT1959289	hsa-miR-498	CLIP-seq
MIRT2446560	hsa-miR-577	CLIP-seq
MIRT874585	hsa-miR-106a	CLIP-seq
MIRT874586	hsa-miR-106b	CLIP-seq
MIRT874587	hsa-miR-1224-3p	CLIP-seq
MIRT874588	hsa-miR-1234	CLIP-seq
MIRT874589	hsa-miR-1245	CLIP-seq
MIRT874595	hsa-miR-150	CLIP-seq
MIRT874596	hsa-miR-17	CLIP-seq
MIRT874598	hsa-miR-1913	CLIP-seq
MIRT874599	hsa-miR-20a	CLIP-seq
MIRT874600	hsa-miR-20b	CLIP-seq
MIRT874601	hsa-miR-302a	CLIP-seq
MIRT874602	hsa-miR-302b	CLIP-seq
MIRT874603	hsa-miR-302c	CLIP-seq
MIRT874604	hsa-miR-302d	CLIP-seq
MIRT874608	hsa-miR-324-3p	CLIP-seq
MIRT874613	hsa-miR-372	CLIP-seq
MIRT874614	hsa-miR-373	CLIP-seq
MIRT874627	hsa-miR-4695-3p	CLIP-seq
MIRT874630	hsa-miR-513c	CLIP-seq
MIRT874631	hsa-miR-514b-5p	CLIP-seq
MIRT874632	hsa-miR-519d	CLIP-seq
MIRT874633	hsa-miR-520g	CLIP-seq
MIRT874638	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
EGR1	Unknown	10510368
NFKB1	Unknown	16365455
RELA	Unknown	16365455
SP1	Unknown	10510368

Show/Hide all(60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IEA
GO:0001819	Process	Positive regulation of cytokine production	TAS	8717514
GO:0002376	Process	Immune system process	IEA
GO:0002863	Process	Positive regulation of inflammatory response to antigenic stimulus	IEA
GO:0005515	Function	Protein binding	IPI	7568038, 7584133, 7807015, 8146197, 8183372, 9417079, 9784967, 10820259, 11285224, 15067037, 15554700, 18641334, 21931534
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	11390434
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9784967
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006955	Process	Immune response	IEA
GO:0006959	Process	Humoral immune response	TAS	8717514
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9784967
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	11390434
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	15067037
GO:0009986	Component	Cell surface	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	23817958
GO:0010629	Process	Negative regulation of gene expression	IMP	23817958
GO:0015026	Function	Coreceptor activity	TAS	9784967
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0031295	Process	T cell costimulation	IBA
GO:0031295	Process	T cell costimulation	IDA	8484124
GO:0031295	Process	T cell costimulation	IEA
GO:0031295	Process	T cell costimulation	TAS	8617933
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	8617933
GO:0032743	Process	Positive regulation of interleukin-2 production	IDA	3875683
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IDA	8617933
GO:0035739	Process	CD4-positive, alpha-beta T cell proliferation	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	3159820, 8617933
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	TAS	9784967
GO:0042110	Process	T cell activation	IBA
GO:0042110	Process	T cell activation	IDA	7568038, 7737275
GO:0042110	Process	T cell activation	IDA	23918985
GO:0042110	Process	T cell activation	IGI	18337562
GO:0042129	Process	Regulation of T cell proliferation	IEA
GO:0042802	Function	Identical protein binding	NAS	3159820
GO:0043066	Process	Negative regulation of apoptotic process	TAS	8717514
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0045060	Process	Negative thymic T cell selection	IEA
GO:0045066	Process	Regulatory T cell differentiation	IDA	18641304
GO:0045070	Process	Positive regulation of viral genome replication	NAS	7492435
GO:0045589	Process	Regulation of regulatory T cell differentiation	IEA
GO:0045727	Process	Positive regulation of translation	NAS	12028592
GO:0045840	Process	Positive regulation of mitotic nuclear division	IDA	3159820
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048304	Process	Positive regulation of isotype switching to IgG isotypes	IEA
GO:0050852	Process	T cell receptor signaling pathway	IBA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0098636	Component	Protein complex involved in cell adhesion	IDA	7544393
GO:2000563	Process	Positive regulation of CD4-positive, alpha-beta T cell proliferation	IEA

MIM	HGNC	e!Ensembl
186760	1653	ENSG00000178562

Protein

UniProt ID

P10747

Protein name

T-cell-specific surface glycoprotein CD28 (TP44) (CD antigen CD28)

Protein function

Receptor that plays a role in T-cell activation, proliferation, survival and the maintenance of immune homeostasis (PubMed:1650475, PubMed:7568038). Functions not only as an amplifier of TCR signals but delivers unique signals that control intra

PDB

1YJD , 3WA4 , 5AUL , 5GJH , 5GJI , 6O8D , 7PPN , 7VU5 , 8S6Z , 8W2V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15910	V-set_2	23 → 139	ICOS V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in T-cells and plasma cells, but not in less mature B-cells.

Sequence

MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP
PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR
SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

Sequence length

220

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules T cell receptor signaling pathway Intestinal immune network for IgA production Type I diabetes mellitus Measles PD-L1 expression and PD-1 checkpoint pathway in cancer Autoimmune thyroid disease Systemic lupus erythematosus Rheumatoid arthritis Allograft rejection Graft-versus-host disease Viral myocarditis		PIP3 activates AKT signaling Nef mediated downregulation of CD28 cell surface expression Constitutive Signaling by Aberrant PI3K in Cancer CD28 co-stimulation CD28 dependent PI3K/Akt signaling CD28 dependent Vav1 pathway PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Show/Hide Unknown Diseases (11)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma	N/A	N/A	GWAS
Celiac disease	Celiac disease	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS
Sclerosing Cholangitis	Primary sclerosing cholangitis	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (263)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Spontaneous	Associate	29069644
Acquired Immunodeficiency Syndrome	Associate	10691923, 11882044, 12853703, 16103193, 19299722, 8809127
Acute Coronary Syndrome	Associate	22282196, 25484131, 25527700, 29211854
Adenocarcinoma	Associate	32509861
Adenocarcinoma of Lung	Associate	32967633, 36225197, 38011277
Alveolitis Extrinsic Allergic	Associate	20030671
Alzheimer Disease	Associate	34427746, 40369481
Amyotrophic Lateral Sclerosis	Associate	36359827
Anemia Aplastic	Associate	11698122, 27036622, 29419434
Anthropophobia	Stimulate	34831335
Aortic Valve Calcification of	Associate	21677140
Aortic Valve Disease	Associate	30810667
Arthritis	Associate	31400229
Arthritis Juvenile	Associate	23686519
Arthritis Rheumatoid	Inhibit	12591902, 16200579, 20738421, 24019115
Arthritis Rheumatoid	Associate	12847680, 12878725, 14726963, 15535835, 17195207, 17565371, 17675524, 19394279, 19843577, 19898481, 19904767, 21508506, 22385242, 22594821, 23045162 View all (11 more)
Arthritis Rheumatoid	Stimulate	23165362, 33291545
Ascites	Associate	10606960
Asthma	Associate	15958078, 36271469, 40551049
Atherosclerosis	Associate	21677140, 24347824
Autoimmune Diseases	Associate	11602626, 15086406, 16106102, 19220836, 19672595, 27211045, 28466476, 32875738, 33291545, 35589883, 36389676
Behcet Syndrome	Associate	15196263, 15545055, 26222305, 27922688, 33124559
Berylliosis	Associate	18768897
Bone Diseases	Associate	29472917
Bone Diseases Metabolic	Associate	29472917
Bone Resorption	Stimulate	24298980
Breast Neoplasms	Associate	18507020, 18566447, 23133541, 29089469, 9878115
Bronchiolitis Obliterans Syndrome	Associate	18617642, 23607447, 25266000
Bronchiolitis Obliterans Syndrome	Stimulate	21682596
Carcinogenesis	Associate	31195368
Carcinoma Hepatocellular	Associate	31235485, 35349565
Carcinoma Non Small Cell Lung	Associate	17668204, 28624781, 35263569, 35318258, 37898752
Carcinoma Pancreatic Ductal	Stimulate	37256126
Carcinoma Renal Cell	Associate	27292320, 32814710
Cardiomyopathy Dilated	Associate	27974462
Cardiovascular Diseases	Associate	19299722, 36159840
Carney Complex	Associate	37151356
CD59 Deficiency	Associate	29419434
Celiac Disease	Associate	19672595, 26859134, 36271469
Cerebral Hemorrhage	Associate	29651892
Cerebral Infarction	Associate	29651892
Cholangiocarcinoma	Associate	40410708
Cholangitis Sclerosing	Inhibit	24726754, 35281002
Chronic Disease	Associate	19394279
Chronic Periodontitis	Stimulate	25788457
Cognition Disorders	Associate	19220836, 34427746
Colitis Ulcerative	Associate	36271469
Colorectal Neoplasms	Associate	10602890, 16188919, 16371631, 26957265
Common Variable Immunodeficiency	Inhibit	10760795
Common Variable Immunodeficiency	Associate	10844530, 16412063, 17223965, 20629103, 28054583, 7905793
Congenital contractural arachnodactyly	Associate	21873805
Coronary Artery Disease	Associate	14535969, 18832677
Coronary Artery Disease	Inhibit	40508061
Coronary Disease	Associate	18832677, 35958279
Coronary Stenosis	Inhibit	40508061
COVID 19	Associate	33237528, 36389676
Critical Illness	Associate	28484052
Cryptogenic Organizing Pneumonia	Associate	10678620
Cytokine Release Syndrome	Associate	11062606, 34427670
Cytomegalovirus Infections	Associate	14535969, 18173357, 18925328, 19415272, 20034645, 22182806, 22865914, 24148296, 26603521, 27314055, 28087817, 28683106, 32369455, 34456907, 36831183, 39285316 View all (1 more)
Cytomegalovirus Infections	Inhibit	20562332, 32229536
Cytomegalovirus Infections	Stimulate	28040323
Dermatitis Atopic	Associate	11886533
Dermatitis Atopic 1	Associate	11028864
Dermatitis Contact	Associate	7523532
Diabetes Gestational	Associate	36203592
Diabetes Mellitus	Associate	22230325
Diabetes Mellitus Type 1	Associate	11927616, 19672595, 25421756, 31068940, 39777226
Diabetes Mellitus Type 2	Associate	30270447, 33958973
Diabetic Angiopathies	Associate	11369787
Diabetic Nephropathies	Associate	33958973
Down Syndrome	Associate	25222269
Drug Hypersensitivity	Associate	15958078, 9378492
Drug Related Side Effects and Adverse Reactions	Associate	10910918, 17656004, 18832677, 25484131, 9158110
Drug Related Side Effects and Adverse Reactions	Stimulate	19930596
Endometrial Neoplasms	Associate	36199963
Epstein Barr Virus Infections	Associate	12050373, 1965352
Esophageal Neoplasms	Associate	27577071
Fatigue Syndrome Chronic	Associate	35943990
Frailty	Associate	35766906
Gastrointestinal Diseases	Associate	17362263
general anxiety disorder	Associate	38264647
Genetic Diseases Inborn	Associate	33205842
Glioblastoma	Associate	34103370, 37605497
Graft vs Host Disease	Associate	12930376, 18925328
Granuloma	Associate	10337027, 12000723, 7507734
Granulomatosis with Polyangiitis	Associate	11562512, 12000723, 28040323, 9764612
Granulomatosis with Polyangiitis	Inhibit	11678911
Granulomatous Disease Chronic	Associate	11562512
Graves Disease	Associate	27638540
Graves Ophthalmopathy	Associate	25653477, 27638540
Harlequin type ichthyosis	Associate	34614112
Hashimoto Disease	Associate	28660994
Head and Neck Neoplasms	Associate	36983005
Heart Diseases	Associate	18617642
Hemochromatosis	Associate	9067531
Hepatic Encephalopathy	Associate	28751644
Hepatitis B	Associate	24188429
Hereditary Breast and Ovarian Cancer Syndrome	Associate	23133541
HIV Infections	Inhibit	10193417, 11122240, 23635305, 32187205, 7539725
HIV Infections	Associate	10193418, 10691923, 11882044, 16011533, 17376193, 19131896, 20104487, 21695776, 22345473, 24586783, 27314055, 29170390, 32229536, 36753067, 8809127, 9328113, 9328114, 9665971, 9764607 View all (4 more)
Hodgkin Disease	Associate	7507734, 8704179
HTLV I Infections	Associate	15831709, 9733871
HTLV I Infections	Inhibit	7504294
Huntington Disease	Stimulate	11972629
Hypertension Portal	Inhibit	34930041
Hypoxia Brain	Associate	27731374
Idiopathic Pulmonary Fibrosis	Associate	10678620, 20126467, 24089408
IgA Vasculitis	Associate	7503950
Immune System Diseases	Associate	15138491, 15730400, 24376655, 29691917
Immunologic Deficiency Syndromes	Associate	16011533
Infections	Inhibit	10364271
Infections	Associate	10516042, 17362263, 23822699, 9378492
Infections	Stimulate	15879023
Infectious Mononucleosis	Associate	12050373, 1965352
Inflammation	Associate	11062606, 15545055, 16106102, 19843577, 19904767, 20126467, 22282196, 23045162, 24313359, 24885856, 25222269, 25484131, 27769261, 28407008, 29066026 View all (6 more)
Inflammation	Stimulate	20145548
Inflammation	Inhibit	29619032
Inflammatory Bowel Diseases	Associate	20629103
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	22985026
Keloid	Stimulate	36012134
Kidney Diseases	Associate	26603521
Kidney Diseases	Inhibit	27413076
Legg Calve Perthes Disease	Inhibit	38139422
Leishmaniasis Cutaneous	Associate	15716079
Leprosy	Associate	23283468
Leprosy	Inhibit	9472661
Leprosy Borderline	Inhibit	9472661
Leprosy Lepromatous	Inhibit	23283468, 9472661
Leukemia	Associate	21046101, 29697355, 36960073, 8098345
Leukemia Biphenotypic Acute	Associate	23515080
Leukemia Large Granular Lymphocytic	Associate	15198732, 18086899
Leukemia Lymphocytic Chronic B Cell	Inhibit	11298591, 15138491
Leukemia Lymphocytic Chronic B Cell	Associate	15699173, 29697355
Leukemia Lymphoma Adult T Cell	Associate	17970785, 2713499, 31961925, 33205842, 34738707, 35417939
Leukemia Myeloid Acute	Associate	25757160, 26295610, 29697355, 36960073
Leukemia Plasma Cell	Associate	34500493
Leukemia Prolymphocytic T Cell	Associate	10086799, 15138491
Leukemia T Cell	Associate	10849438, 38233409
Lichen Planus	Associate	7523532
Limb girdle muscular dystrophy type 2B	Associate	18832576
Liver Cirrhosis Biliary	Associate	28425483, 36271469
Liver Failure Acute	Associate	29229400
Lung Diseases	Associate	24024324
Lung Diseases Interstitial	Associate	20030671, 33298584, 35589883
Lung Neoplasms	Associate	24024324, 26711627, 32967633
Lupus Erythematosus Systemic	Stimulate	15086406
Lupus Erythematosus Systemic	Associate	15356113, 18641361, 19672595, 24433387, 25098715, 27446964, 29066026, 32576231, 36189300, 8603537
Lupus Erythematosus Systemic	Inhibit	17469136, 8918566
Lupus Nephritis	Associate	27446964
Lymphoma	Associate	22308288
Lymphoma Extranodal NK T Cell	Associate	26819049
Lymphoma Follicular	Associate	30784598
Lymphoma Large B Cell Diffuse	Associate	31195368
Lymphoma Non Hodgkin	Associate	12853703, 20815894
Lymphoma T Cell	Associate	26719098, 26819049, 27369867, 9767448
Lymphoma T Cell	Inhibit	8704179
Lymphoma T Cell Cutaneous	Associate	18569641, 8098345
Lymphoma T Cell Peripheral	Associate	26719098, 34147695
Lymphoproliferative Disorders	Associate	17302894, 22048771
Macular Degeneration	Associate	29165313
Malformations of Cortical Development Group II	Associate	28112205
Malnutrition	Associate	17362263
Mastitis	Stimulate	39399489
Melanoma	Associate	10382762, 10823418, 11169413, 12357321, 15345595, 15889254, 15944290, 19672595, 22199267
Monoclonal Gammopathy of Undetermined Significance	Associate	9626070
Mouth Neoplasms	Associate	36983005
Multiple Myeloma	Associate	10848782, 12853703, 17311991, 23450831, 25860485, 27809856, 29089645, 30128739, 35380688, 36982802, 7522634
Multiple Myeloma	Inhibit	14717778
Multiple Organ Failure	Associate	34177897
Multiple Sclerosis	Associate	11602626, 31068940, 31212712, 36271469, 36535763, 9466965
Multiple Sclerosis Relapsing Remitting	Associate	31212712
Myasthenia Gravis	Associate	34794447
Mycobacterium Infections Nontuberculous	Inhibit	16721821
Myelodysplastic Syndromes	Associate	11698122
Myocardial Infarction	Associate	19394279, 19843577
Myositis	Associate	10433938
Myositis Inclusion Body	Stimulate	10433938
Myositis Inclusion Body	Associate	24594700
Nasopharyngeal Carcinoma	Associate	36438903
Necrosis	Stimulate	35943990
Neoplasm Metastasis	Associate	12357321
Neoplasms	Associate	10382762, 10942368, 11169413, 11371607, 12357321, 15115782, 15345595, 16188919, 16371631, 16734614, 17668204, 18337305, 18566447, 19299722, 19685052 View all (37 more)
Neoplasms	Stimulate	34103370
Neoplastic Syndromes Hereditary	Associate	20015273, 9067531
Nephritis Interstitial	Associate	11302869
Nephrotic Syndrome	Inhibit	23607447
Nephrotic Syndrome	Associate	27769261
Opioid Related Disorders	Associate	38022645
Osteoarthritis	Associate	20430731
Osteoporosis	Associate	29472917
Ovarian Neoplasms	Associate	10606960, 25712684, 26166762
Ovarian Neoplasms	Inhibit	36837407
Papilloma	Associate	22322668
Paraparesis Tropical Spastic	Associate	18502825, 19766325
Paraproteinemias	Associate	30128739
Parkinson Disease	Associate	29807534
Pemphigus	Associate	32875738
Peritoneal Neoplasms	Associate	10606960
Peritonitis	Associate	34360900
Persistent Infection	Associate	24298980
Persistent Mullerian duct syndrome	Associate	26719098
Pituitary Neoplasms	Associate	34257554
Plaque Atherosclerotic	Associate	18832677, 19843577, 22282196
Pleural Effusion Malignant	Associate	29785404
Pneumonia	Associate	12952926
Polymyositis	Stimulate	10433938
Pre Eclampsia	Associate	22837649
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	12930376, 38233409
Primary Immunodeficiency Diseases	Associate	28112205
Prostatic Hyperplasia	Associate	26993768, 7545097
Prostatic Neoplasms	Associate	28101800, 33293427
Psoriasis	Associate	10974034
Pulmonary Disease Chronic Obstructive	Associate	16611655, 19220836, 24885856, 26498345, 27769261
Pulmonary Disease Chronic Obstructive	Stimulate	25573300, 32270742
Purpura Thrombocytopenic Idiopathic	Associate	26211942, 26287565, 30403287, 32677050, 33584705
Purpura Thrombocytopenic Idiopathic	Inhibit	28466476
Pyruvate Carboxylase Deficiency Disease	Associate	36752202
Renal Artery Obstruction	Associate	38031731
Renal Insufficiency	Associate	34177897
Renal Insufficiency Chronic	Associate	24347824, 25866451
Respiratory Tract Diseases	Associate	40234829
Rupture	Associate	19394279, 19843577
Sarcoidosis	Associate	20030671, 32764642, 7586698
Sarcoma Kaposi	Associate	23435301
Schistosomiasis	Inhibit	12193234
Scleroderma Systemic	Associate	12687555
Scleroderma Systemic	Stimulate	15086406
Sepsis	Associate	22187279
Severe combined immunodeficiency due to adenosine deaminase deficiency	Associate	18218852
Sialadenitis	Associate	11302869
Sjogren's Syndrome	Stimulate	15086406
Sjogren's Syndrome	Inhibit	29992636
Sjogren's Syndrome	Associate	30336792
Skin Diseases	Associate	33777045, 7523532
Smoldering Multiple Myeloma	Inhibit	26668134
Smooth Muscle Tumor	Associate	32625199
Spinal Cord Injuries	Inhibit	38139422
Spondylitis Ankylosing	Associate	12932293, 16219708, 40389847
Squamous Cell Carcinoma of Head and Neck	Associate	32281488, 36983005
Status Asthmaticus	Stimulate	15958078
Status Asthmaticus	Associate	16106102, 22768198
T cell immunodeficiency primary	Associate	7915976
Takayasu Arteritis	Associate	35126357
Tang Hsi Ryu syndrome	Associate	30336792, 33196557
Thyroiditis Autoimmune	Associate	19672595
Tn Syndrome	Associate	29892290
Triple Negative Breast Neoplasms	Associate	40613791
Tuberculosis	Associate	22230325, 37460564
Tuberculosis Central Nervous System	Associate	22111973
Tuberculosis Pulmonary	Associate	12519392
Uremia	Associate	23809614
Uterine Cervical Dysplasia	Associate	12121440
Uterine Cervical Dysplasia	Inhibit	32518078
Uterine Cervical Neoplasms	Associate	18337305, 22094905
Uterine Cervicitis	Associate	12519392
Uveitis	Associate	15196263
Vascular Diseases	Associate	26603521, 33196557
Vascular System Injuries	Associate	11369787, 25484131
Viremia	Associate	18925328, 36204811
Virus Diseases	Associate	10910918, 11145666, 33237528
Wells syndrome	Associate	17362263
X Linked Combined Immunodeficiency Diseases	Associate	27647349, 32625199

CD28 (CD28 molecule)