Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	93664
Gene name Gene Name - the full gene name approved by the HGNC.	Calcium dependent secretion activator 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CADPS2
Synonyms (NCBI Gene) Gene synonyms aliases	CAPS2
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q31.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the calcium-dependent activator of secretion (CAPS) protein family, which are calcium binding proteins that regulate the exocytosis of synaptic and dense-core vesicles in neurons and neuroendocrine cells. Mutations in this ge

Show/Hide all(26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018754	hsa-miR-335-5p	Microarray	18185580
MIRT024929	hsa-miR-215-5p	Microarray	19074876
MIRT026747	hsa-miR-192-5p	Microarray	19074876
MIRT047976	hsa-miR-30c-5p	CLASH	23622248
MIRT858692	hsa-miR-1228	CLIP-seq
MIRT858693	hsa-miR-3129-3p	CLIP-seq
MIRT858694	hsa-miR-4450	CLIP-seq
MIRT858695	hsa-miR-4667-5p	CLIP-seq
MIRT858696	hsa-miR-4700-5p	CLIP-seq
MIRT1954960	hsa-miR-4762-5p	CLIP-seq
MIRT1954961	hsa-miR-4778-3p	CLIP-seq
MIRT2192570	hsa-miR-1243	CLIP-seq
MIRT2192571	hsa-miR-2276	CLIP-seq
MIRT2192572	hsa-miR-329	CLIP-seq
MIRT2192573	hsa-miR-362-3p	CLIP-seq
MIRT2192574	hsa-miR-3654	CLIP-seq
MIRT2192575	hsa-miR-374a	CLIP-seq
MIRT2192576	hsa-miR-374b	CLIP-seq
MIRT2192577	hsa-miR-3941	CLIP-seq
MIRT2192578	hsa-miR-548ag	CLIP-seq
MIRT2192579	hsa-miR-548ai	CLIP-seq
MIRT2192580	hsa-miR-603	CLIP-seq
MIRT2426866	hsa-miR-3605-5p	CLIP-seq
MIRT2426867	hsa-miR-4731-3p	CLIP-seq
MIRT2426868	hsa-miR-4801	CLIP-seq
MIRT2426869	hsa-miR-583	CLIP-seq

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	38538594
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IDA	38538594
GO:0005929	Component	Cilium	IEA
GO:0006887	Process	Exocytosis	IBA
GO:0006887	Process	Exocytosis	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016079	Process	Synaptic vesicle exocytosis	IEA
GO:0016082	Process	Synaptic vesicle priming	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0036064	Component	Ciliary basal body	IDA	38538594
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045921	Process	Positive regulation of exocytosis	IBA
GO:0045921	Process	Positive regulation of exocytosis	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1990504	Process	Dense core granule exocytosis	IEA

MIM	HGNC	e!Ensembl
609978	16018	ENSG00000081803

Protein

UniProt ID

Q86UW7

Protein name

Calcium-dependent secretion activator 2 (Calcium-dependent activator protein for secretion 2) (CAPS-2)

Protein function

Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. Regulates neurotrophin release from granu

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	488 → 590	PH domain	Domain
PF06292	DUF1041	801 → 894	Domain of Unknown Function (DUF1041)	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in all adult and fetal tissues examined, with the strongest expression in kidney and pancreas. In brain, it is expressed at high levels in cerebellum, to a lesser degree in cerebral cortex, occipital pole, a

Sequence

MLDPSSSEEESDEGLEEESRDVLVAAGSSQRAPPAPTREGRRDAPGRAGGGGAARSVSPS
PSVLSEGRDEPQRQLDDEQERRIRLQLYVFVVRCIAYPFNAKQPTDMARRQQKLNKQQLQ
LLKERFQAFLNGETQIVADEAFCNAVRSYYEVFLKSDRVARMVQSGGCSANDFREVFKKN
IEKRVRSLPEIDGLSKETVLSSWIAKYDAIYRGEEDLCKQPNRMALSAVSELILSKEQLY
EMFQQILGIKKLEHQLLYNACQLDNADEQAAQIRRELDGRLQLADKMAKERKFPKFIAKD
MENMYIEELRSSVNLLMANLESLPVSKGGPEFKLQKLKRSQNSAFLDIGDENEIQLSKSD
VVLSFTLEIVIMEVQGLKSVAPNRIVYCTMEVEGEKLQTDQAEASRPQWGTQGDFTTTHP
RPVVKVKLFTESTGVLALEDKELGRVILYPTSNSSKSAELHRMVVPKNSQDSDLKIKLAV
RMDKPAHMKHSGYLYALGQKVWKRWKKRYFVLVQVSQYTFAMCSYREKKSEPQELMQLEG
YTVDYTDPHPGLQGGCMFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSYKPVPAIQ
TQKLNPKGGTLHADAQLSGKDADRFQKHGMDEFISANPCKLDHAFLFRILQRQTLDHRLN
DSYSCLGWFSPGQVFVLDEYCARYGVRGCHRHLCYLAELMEHSENGAVIDPTLLHYSFAF
CASHVHGNRPDGIGTVSVEEKERFEEIKERLSSLLENQISHFRYCFPFGRPEGALKATLS
LLERVLMKDIATPIPAEEVKKVVRKCLEKAALINYTRLTEYAKIEETMNQASPARKLEEI
LHLAELCIEVLQQNEEHHAEGREAFAWWPDLLAEHAEKFWALFTVDMDTALEAQPQDSWD
SFPLFQLLNNFLRNDTLLCNGKFHKHLQEIFVPLVVRYVDLMESSIAQSIHRGFEQETWQ
PVKNIANSLPNVALPKVPSLPLNLPQIPNISTASWMPSLYESTNGSATSEDLFWKLDALQ
MFVFDLHWPEQEFAHHLEQRLKLMASDMLEACVKRTRTAFELKLQKASKTTDLRIPASVC
TMFNVLVDAKKQSTKLCALDGGQEQQYHSKIDDLIDNSVKEIISLLVSKFVSVLEGVLSK
LSRYDEGTFFSSILSFTVKAAAKYVDVPKPGMDLADTYIMFVRQNQDILREKVNEEMYIE
KLFDQWYSSSMKVICVWLTDRLDLQLHIYQLKTLIKIVKKTYRDFRLQGVLEGTLNSKTY
DTVHRRLTVEEATASVSEGGGLQGITMKDSDEEEEG

Sequence length

1296

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Attention Deficit Hyperactivity Disorder	Attention deficit hyperactivity disorder	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	22710270
Attention Deficit Disorder with Hyperactivity	Associate	36774336
Autism Spectrum Disorder	Associate	23715297
Autistic Disorder	Associate	23715297
Breast Neoplasms	Associate	29867227
Memory Disorders	Associate	36774336
Neoplasms	Associate	29867227
Neurologic Manifestations	Associate	23715297
Parkinson Disease	Associate	34919646

CADPS2 (calcium dependent secretion activator 2)