Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	93650
Gene name Gene Name - the full gene name approved by the HGNC.	Acid phosphatase 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ACP4
Synonyms (NCBI Gene) Gene synonyms aliases	ACPT, AI1J
Disease Acronyms (UniProt) Disease acronyms from UniProt database	AI1J
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003993	Function	Acid phosphatase activity	IBA	21873635
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA	21873635
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	15219672
GO:0005764	Component	Lysosome	IBA	21873635
GO:0007040	Process	Lysosome organization	IBA	21873635
GO:0010955	Process	Negative regulation of protein processing	IMP	15219672
GO:0010977	Process	Negative regulation of neuron projection development	IDA	15219672
GO:0016021	Component	Integral component of membrane	IEA
GO:0016311	Process	Dephosphorylation	IBA	21873635
GO:0016791	Function	Phosphatase activity	IBA	21873635
GO:0030971	Function	Receptor tyrosine kinase binding	IBA	21873635
GO:0030971	Function	Receptor tyrosine kinase binding	IDA	15219672
GO:0042476	Process	Odontogenesis	IMP	27843125
GO:0045211	Component	Postsynaptic membrane	IBA	21873635
GO:0048168	Process	Regulation of neuronal synaptic plasticity	IBA	21873635
GO:0048168	Process	Regulation of neuronal synaptic plasticity	IDA	15219672
GO:0120154	Process	Negative regulation of ERBB4 signaling pathway	IBA	21873635
GO:0120154	Process	Negative regulation of ERBB4 signaling pathway	IDA	15219672
GO:1990264	Process	Peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IBA	21873635
GO:1990264	Process	Peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IDA	15219672

MIM	HGNC	e!Ensembl
606362	14376	ENSG00000142513

Protein

UniProt ID

Q9BZG2

Protein name

Testicular acid phosphatase (EC 3.1.3.2) (Acid phosphatase 4)

Protein function

May dephosphorylate receptor tyrosine-protein kinase ERBB4 and inhibits its ligand-induced proteolytic cleavage (PubMed:15219672). May play a role in odontogenesis (PubMed:27843125).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00328	His_Phos_2	31 → 321	Histidine phosphatase superfamily (branch 2)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed mainly in the testis. Also expressed in the brain where they are enriched at the postsynaptic sites. Expressed at lower levels in the trachea, prostate, bone marrow, spinal cord, colon, fetal brain, heart, thymus, fetal liver

Sequence

MAGLGFWGHPAGPLLLLLLLVLPPRALPEGPLVFVALVFRHGDRAPLASYPMDPHKEVAS
TLWPRGLGQLTTEGVRQQLELGRFLRSRYEAFLSPEYRREEVYIRSTDFDRTLESAQANL
AGLFPEAAPGSPEARWRPIPVHTVPVAEDKLLRFPMRSCPRYHELLREATEAAEYQEALE
GWTGFLSRLENFTGLSLVGEPLRRAWKVLDTLMCQQAHGLPLPAWASPDVLRTLAQISAL
DIGAHVGPPRAAEKAQLTGGILLNAILANFSRVQRLGLPLKMVMYSAHDSTLLALQGALG
LYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRNDSAHLPLPLSLPGCPAPCPLG
RFYQLTAPARPPAHGVSCHGPYEAAIPPAPVVPLLAGAVAVLVALSLGLGLLAWRPGCLR
ALGGPV

Sequence length

426

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Amelogenesis imperfecta	Amelogenesis Imperfecta, Amelogenesis imperfecta local hypoplastic form, AMELOGENESIS IMPERFECTA, TYPE IJ	rs267607178, rs143816093, rs606231351, rs137854435, rs137854440, rs137854441, rs137854444, rs587776587, rs121908109, rs587776588, rs140213840, rs104894704, rs387906487, rs387906488, rs387906489 View all (70 more)	28513613, 27843125

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Amelogenesis Imperfecta	Associate	27843125, 34036831
Amelogenesis imperfecta local hypoplastic form	Associate	27843125, 28513613, 34036831

ACP4 (acid phosphatase 4)