CD163 (CD163 molecule)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9332
Gene name Gene Name - the full gene name approved by the HGNC.
CD163 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD163
Synonyms (NCBI Gene) Gene synonyms aliases
M130, MM130, SCARI1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the scavenger receptor cysteine-rich (SRCR) superfamily, and is exclusively expressed in monocytes and macrophages. It functions as an acute phase-regulated receptor involved in the clearance and endocytosis
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(45)
miRTarBase ID miRNA Experiments Reference
MIRT873739 hsa-miR-15a CLIP-seq
MIRT873740 hsa-miR-15b CLIP-seq
MIRT873741 hsa-miR-16 CLIP-seq
MIRT873742 hsa-miR-195 CLIP-seq
MIRT873743 hsa-miR-214 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
Transcription factor Regulation Reference
CEBPA Unknown 10725797
ETS2 Unknown 10725797
SP1 Unknown 10725797
SPI1 Unknown 10725797
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0005044 Function Scavenger receptor activity NAS 8370408
GO:0005515 Function Protein binding IPI 15479433, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane IDA
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605545 1631 ENSG00000177575
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q86VB7
Protein name Scavenger receptor cysteine-rich type 1 protein M130 (Hemoglobin scavenger receptor) (CD antigen CD163) [Cleaved into: Soluble CD163 (sCD163)]
Protein function Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling o
PDB 8XMK , 8XMP , 8XMQ , 8XMW , 9FHB , 9FMU , 9FNO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00530 SRCR 54 → 152 Scavenger receptor cysteine-rich domain Domain
PF00530 SRCR 162 → 259 Scavenger receptor cysteine-rich domain Domain
PF00530 SRCR 269 → 366 Scavenger receptor cysteine-rich domain Domain
PF00530 SRCR 376 → 473 Scavenger receptor cysteine-rich domain Domain
PF00530 SRCR 481 → 578 Scavenger receptor cysteine-rich domain Domain
PF00530 SRCR 586 → 683 Scavenger receptor cysteine-rich domain Domain
PF00530 SRCR 722 → 819 Scavenger receptor cysteine-rich domain Domain
PF00530 SRCR 829 → 926 Scavenger receptor cysteine-rich domain Domain
PF00530 SRCR 932 → 1029 Scavenger receptor cysteine-rich domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous
Sequence 
MSKLRMVLLEDSGSADFRRHFVNLSPFTITVVLLLSACFVTSSLGGTDKELRLVDGENKC
SGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSC
RGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRW
GTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKH
QGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDA
AVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAIWQCKHHEWGKHYCNHNED
AGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGLKEADVVCRQLGCGSAL
KTSYQVYSKIQATNTWLFLSSCNGNETSLWDCKNWQWGGLTCDHYEEAKITCSAHREPRL
VGGDIPCSGRVEVKHGDTWGSICDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQI
WAEEFQCEGHESHLSLCPVAPRPEGTCSHSRDVGVVCSRYTEIRLVNGKTPCEGRVELKT
LGAWGSLCNSHWDIEDAHVLCQQLKCGVALSTPGGARFGKGNGQIWRHMFHCTGTEQHMG
DCPVTALGASLCPSEQVASVICSGNQSQTLSSCNSSSLGPTRPTIPEESAVACIESGQLR
LVNGGGRCAGRVEIYHEGSWGTICDDSWDLSDAHVVCRQLGCGEAINATGSAHFGEGTGP
IWLDEMKCNGKESRIWQCHSHGWGQQNCRHKEDAGVICSEFMSLRLTSEASREACAGRLE
VFYNGAWGTVGKSSMSETTVGVVCRQLGCADKGKINPASLDKAMSIPMWVDNVQCPKGPD
TLWQCPSSPWEKRLASPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDL
DDAQVVCQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHSECGH
KEDAAVNCTDISVQKTPQKATTGRSSRQSSFIAVGILGVVLLAIFVALFFLTKKRRQRQR
LAVSSRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKFLPISGM
EKEAILSHTEKENGNL
Sequence length 1156
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Scavenging of heme from plasma
CD163 mediating an anti-inflammatory response
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (5)
Causal
Disease term Disease name dbSNP ID References
Glomerulonephritis IGA Glomerulonephritis rs778043831 25133636
Hyperinsulinism Hyperinsulinism rs387906407, rs151344623, rs121913156, rs137853245, rs80356655, rs104894010, rs104894012, rs104894014, rs104894015, rs137852676, rs587783169, rs72559716, rs541269678, rs151344624, rs797045209
View all (23 more)		 29035695
Moyamoya disease Arterial Diseases, Common Carotid rs121434527, rs121434528, rs387906592, rs397514563, rs797045187, rs1555675538, rs1568149971, rs1599150380, rs2079443410 17095719
Obesity Obesity rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562
View all (27 more)		 29035695
Show/Hide Text Mining Associations (312)
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Stimulate 25740391
Acute Disease Associate 23687420, 32615997
Acute On Chronic Liver Failure Associate 23687420
Adenocarcinoma of Lung Associate 37061716, 38266813
Adrenoleukodystrophy Associate 29860501
AIDS Arteritis Central Nervous System Associate 27021071
AIDS Associated Nephropathy Associate 29369399
Alexander Disease Associate 25516918
Alzheimer Disease Associate 40465637
Anemia Aplastic Associate 36469034