Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9308
Gene name Gene Name - the full gene name approved by the HGNC.	CD83 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD83
Synonyms (NCBI Gene) Gene synonyms aliases	BL11, HB15
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p23
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to

Show/Hide all(99)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002516	hsa-miR-373-3p	Microarray	15685193
MIRT002516	hsa-miR-373-3p	Microarray;Other	15685193
MIRT021231	hsa-miR-146a-5p	Other	20375304
MIRT023390	hsa-miR-122-5p	Microarray	17612493
MIRT024870	hsa-miR-215-5p	Microarray	19074876
MIRT026759	hsa-miR-192-5p	Microarray	19074876
MIRT876291	hsa-miR-1324	CLIP-seq
MIRT876292	hsa-miR-137	CLIP-seq
MIRT876293	hsa-miR-1825	CLIP-seq
MIRT876294	hsa-miR-194	CLIP-seq
MIRT876295	hsa-miR-198	CLIP-seq
MIRT876296	hsa-miR-199a-5p	CLIP-seq
MIRT876297	hsa-miR-199b-5p	CLIP-seq
MIRT876298	hsa-miR-22	CLIP-seq
MIRT876299	hsa-miR-3136-5p	CLIP-seq
MIRT876300	hsa-miR-3925-3p	CLIP-seq
MIRT876301	hsa-miR-3977	CLIP-seq
MIRT876302	hsa-miR-4279	CLIP-seq
MIRT876303	hsa-miR-4439	CLIP-seq
MIRT876304	hsa-miR-4459	CLIP-seq
MIRT876305	hsa-miR-4513	CLIP-seq
MIRT876306	hsa-miR-4659a-3p	CLIP-seq
MIRT876307	hsa-miR-4659b-3p	CLIP-seq
MIRT876308	hsa-miR-4691-5p	CLIP-seq
MIRT876309	hsa-miR-4768-5p	CLIP-seq
MIRT876310	hsa-miR-4778-3p	CLIP-seq
MIRT876311	hsa-miR-563	CLIP-seq
MIRT876312	hsa-miR-665	CLIP-seq
MIRT876313	hsa-miR-942	CLIP-seq
MIRT876314	hsa-miR-4700-3p	CLIP-seq
MIRT876315	hsa-miR-548v	CLIP-seq
MIRT876306	hsa-miR-4659a-3p	CLIP-seq
MIRT876307	hsa-miR-4659b-3p	CLIP-seq
MIRT1959689	hsa-miR-302a	CLIP-seq
MIRT1959690	hsa-miR-302b	CLIP-seq
MIRT1959691	hsa-miR-302c	CLIP-seq
MIRT1959692	hsa-miR-302d	CLIP-seq
MIRT1959693	hsa-miR-302e	CLIP-seq
MIRT1959694	hsa-miR-3665	CLIP-seq
MIRT1959695	hsa-miR-372	CLIP-seq
MIRT1959696	hsa-miR-373	CLIP-seq
MIRT1959697	hsa-miR-376c	CLIP-seq
MIRT1959698	hsa-miR-4464	CLIP-seq
MIRT1959699	hsa-miR-4748	CLIP-seq
MIRT1959700	hsa-miR-519a	CLIP-seq
MIRT1959701	hsa-miR-519b-3p	CLIP-seq
MIRT1959702	hsa-miR-519c-3p	CLIP-seq
MIRT1959703	hsa-miR-520a-3p	CLIP-seq
MIRT1959704	hsa-miR-520b	CLIP-seq
MIRT1959705	hsa-miR-520c-3p	CLIP-seq
MIRT1959706	hsa-miR-520d-3p	CLIP-seq
MIRT1959707	hsa-miR-520e	CLIP-seq
MIRT1959708	hsa-miR-657	CLIP-seq
MIRT2196703	hsa-miR-1207-3p	CLIP-seq
MIRT2196704	hsa-miR-15a	CLIP-seq
MIRT2196705	hsa-miR-15b	CLIP-seq
MIRT2196706	hsa-miR-16	CLIP-seq
MIRT2196707	hsa-miR-195	CLIP-seq
MIRT876295	hsa-miR-198	CLIP-seq
MIRT1959689	hsa-miR-302a	CLIP-seq
MIRT1959690	hsa-miR-302b	CLIP-seq
MIRT1959691	hsa-miR-302c	CLIP-seq
MIRT1959692	hsa-miR-302d	CLIP-seq
MIRT1959693	hsa-miR-302e	CLIP-seq
MIRT1959694	hsa-miR-3665	CLIP-seq
MIRT2196708	hsa-miR-3677-5p	CLIP-seq
MIRT1959695	hsa-miR-372	CLIP-seq
MIRT1959696	hsa-miR-373	CLIP-seq
MIRT1959697	hsa-miR-376c	CLIP-seq
MIRT2196709	hsa-miR-424	CLIP-seq
MIRT2196710	hsa-miR-4434	CLIP-seq
MIRT876304	hsa-miR-4459	CLIP-seq
MIRT1959698	hsa-miR-4464	CLIP-seq
MIRT2196711	hsa-miR-4488	CLIP-seq
MIRT2196712	hsa-miR-4516	CLIP-seq
MIRT2196713	hsa-miR-4519	CLIP-seq
MIRT2196714	hsa-miR-4531	CLIP-seq
MIRT2196715	hsa-miR-4640-5p	CLIP-seq
MIRT2196716	hsa-miR-4672	CLIP-seq
MIRT2196717	hsa-miR-4697-5p	CLIP-seq
MIRT2196718	hsa-miR-4726-5p	CLIP-seq
MIRT2196719	hsa-miR-4731-5p	CLIP-seq
MIRT1959699	hsa-miR-4748	CLIP-seq
MIRT2196720	hsa-miR-497	CLIP-seq
MIRT1959700	hsa-miR-519a	CLIP-seq
MIRT1959701	hsa-miR-519b-3p	CLIP-seq
MIRT1959702	hsa-miR-519c-3p	CLIP-seq
MIRT1959703	hsa-miR-520a-3p	CLIP-seq
MIRT1959704	hsa-miR-520b	CLIP-seq
MIRT1959705	hsa-miR-520c-3p	CLIP-seq
MIRT1959706	hsa-miR-520d-3p	CLIP-seq
MIRT1959707	hsa-miR-520e	CLIP-seq
MIRT876311	hsa-miR-563	CLIP-seq
MIRT2196721	hsa-miR-637	CLIP-seq
MIRT1959708	hsa-miR-657	CLIP-seq
MIRT876312	hsa-miR-665	CLIP-seq
MIRT2465072	hsa-miR-3163	CLIP-seq
MIRT2465073	hsa-miR-3688-5p	CLIP-seq
MIRT2465074	hsa-miR-548c-3p	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
NFKB1	Activation	19164127
NFKB1	Unknown	12182451
PPARG	Activation	15356156
RELA	Activation	19164127
SP1	Unknown	12182451
SP3	Unknown	12182451

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20374249, 32296183
GO:0005886	Component	Plasma membrane	TAS	9310491
GO:0005887	Component	Integral component of plasma membrane	TAS	8422464
GO:0006952	Process	Defense response	TAS	1378080
GO:0006959	Process	Humoral immune response	TAS	8422464
GO:0007165	Process	Signal transduction	TAS	9310491
GO:0009897	Component	External side of plasma membrane	IEA
GO:0014070	Process	Response to organic cyclic compound	IEA
GO:0032713	Process	Negative regulation of interleukin-4 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0043372	Process	Positive regulation of CD4-positive, alpha-beta T cell differentiation	IEA

MIM	HGNC	e!Ensembl
604534	1703	ENSG00000112149

Protein

UniProt ID

Q01151

Protein name

CD83 antigen (hCD83) (B-cell activation protein) (Cell surface protein HB15) (CD antigen CD83)

Protein function

Transmembrane glycoprotein predominantly found on the surface of many immune cells including dendritic cells or lymphocytes that plays various roles in immune response regulation. Plays an essential role in CD4(+) T-selection, differentiation an

PDB

5MIX , 5MJ0 , 5MJ1 , 5MJ2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	19 → 127	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by activated lymphocytes, Langerhans cells and activatd dendritic cells. {ECO:0000269|PubMed:11922761}.

Sequence

MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERM
ETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSG
KVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGM
ERAFLPVTSPNKHLGLVTPHKTELV

Sequence length

205

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	22446963

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients		GWAS, CBGDA

Show/Hide Text Mining Associations (99)

Disease Name	Relationship Type	References
Associations from Text Mining
Achondroplasia and Swiss type agammaglobulinemia	Stimulate	12823285
Acne Vulgaris	Associate	25153527
Adenocarcinoma of Lung	Associate	17628801
Amyotrophic Lateral Sclerosis	Associate	20937945
Arthritis	Associate	34691053
Arthritis Psoriatic	Associate	16507115
Arthritis Rheumatoid	Associate	12417058, 18292234, 23577190, 29999150
Bacterial Infections	Associate	12452842
Barrett Esophagus	Associate	19015928
Behcet Syndrome	Associate	36226612
Breast Neoplasms	Associate	37684436
Bronchiolitis	Associate	18256061
Bronchiolitis Obliterans Syndrome	Associate	36622700
Bruton type agammaglobulinemia	Associate	30147693
Carcinoma Basal Cell	Associate	2366004
Carcinoma Hepatocellular	Associate	15965645, 18793383
Carcinoma Pancreatic Ductal	Stimulate	20976171
Carcinoma Squamous Cell	Inhibit	16412062
Carcinoma Squamous Cell	Associate	22134374, 28052400
Cardiomyopathies	Associate	16584112
Chlamydial Pneumonia	Stimulate	19046168
Churg Strauss Syndrome	Associate	12521377
Cicatrix	Associate	25970613
Colitis Ulcerative	Associate	12109441
Colorectal Neoplasms	Associate	16101177
Common Variable Immunodeficiency	Associate	33190167
Coronary Artery Disease	Stimulate	20628522
Crohn Disease	Associate	12594843, 19095953
Cryopyrin Associated Periodic Syndromes	Stimulate	26245468
Dermatitis Atopic	Associate	11241286, 15370698
Diabetes Mellitus Type 1	Associate	22344559
Diabetes Mellitus Type 1	Inhibit	34659254
Drug Hypersensitivity	Stimulate	24785110
Endometrial Neoplasms	Inhibit	39387602
Endometritis	Stimulate	31718829
Esophageal Neoplasms	Associate	15052669
Esophageal Squamous Cell Carcinoma	Associate	36921563
Fibrosis	Associate	36091020
Giant Cell Arteritis	Associate	35045965
Glioblastoma	Associate	36766715
Glioma	Associate	36766715
Gout	Associate	35116032
Graft vs Host Disease	Inhibit	36622700
Granuloma	Associate	22727562
Graves Disease	Stimulate	16285898
Hashimoto Disease	Stimulate	16285898
Heart Failure	Associate	37684436
Hereditary leiomyomatosis and renal cell cancer	Associate	24633193
Hermansky Pudlak syndrome 2	Associate	27207797
Histiocytosis Langerhans Cell	Associate	11241286, 27692140
HIV Infections	Associate	11535497, 26129803
HIV Infections	Inhibit	36499469
Hodgkin Disease	Associate	24633193
HTLV I Infections	Associate	20956799
Huntington Disease	Inhibit	30346851
Infections	Stimulate	11122235
Infections	Associate	12452842
Inflammation	Associate	11676397, 12452842, 12521377, 25970613, 36226612
Inflammation	Stimulate	17301951
Laryngeal Neoplasms	Associate	23632869, 23690219
Leukemia	Associate	10458772
Leukemia Lymphocytic Chronic B Cell	Associate	16113842, 16517754, 18426971
Leukemia Myelogenous Chronic BCR ABL Positive	Inhibit	21526503
Leukemia Myeloid Acute	Associate	11823047, 15183897, 25795133, 36622700, 37596597
Leukemia Myelomonocytic Chronic	Associate	10554809
Leukemia Prolymphocytic T Cell	Associate	22010965
Liver Cirrhosis Biliary	Inhibit	22727562
Lung Neoplasms	Associate	17628801
Lupus Erythematosus Systemic	Inhibit	17056512
Lupus Erythematosus Systemic	Associate	34084162, 39366755
Lymphatic Metastasis	Inhibit	16101177
Lymphoma B Cell	Associate	33945543
Lymphoma Large B Cell Diffuse	Associate	33684939
Lymphoma Large Cell Anaplastic	Associate	24633193
Macular Edema	Associate	24391808
Measles	Associate	17538120
Melanoma	Inhibit	17624244
Melanoma	Associate	18221542, 29538091, 35408802
Multiple Myeloma	Associate	10029574, 10989194
Necrosis	Stimulate	12905492, 16108813
Neoplasms	Associate	15217509, 16101177, 16827115, 17301951, 17628801, 19141400, 22134374, 23632869, 23690219, 33945543, 36674966, 36921563, 37435060
Neoplasms	Stimulate	24512329
Neuritis Autoimmune Experimental	Associate	37137669
Neuromyelitis Optica	Associate	36503481
Ovarian Neoplasms	Inhibit	19955923
Ovarian Neoplasms	Associate	28589429
Prostatic Neoplasms	Associate	37435060
Pulmonary Disease Chronic Obstructive	Associate	15994259, 19729666
Pulmonary Disease Chronic Obstructive	Inhibit	24742278, 25338516
Sarcoma Ewing	Associate	34831294
Squamous Cell Carcinoma of Head and Neck	Associate	16827115, 35293509
Thrombosis	Associate	36226612
Thyroiditis Autoimmune	Associate	16285898
Tuberculosis	Inhibit	32296431
Uterine Cervical Neoplasms	Associate	19446866
Uveitis	Associate	37137669
Vaginosis Bacterial	Associate	17652029
Vitamin D Deficiency	Associate	23527013
Wiskott Aldrich Syndrome	Associate	11745360

CD83 (CD83 molecule)