Gene Gene information from NCBI Gene database.
Entrez ID 9308
Gene name CD83 molecule
Gene symbol CD83
Synonyms (NCBI Gene)
BL11HB15
Chromosome 6
Chromosome location 6p23
Summary The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to
miRNA miRNA information provided by mirtarbase database.
99
miRTarBase ID miRNA Experiments Reference
MIRT002516 hsa-miR-373-3p Microarray 15685193
MIRT002516 hsa-miR-373-3p Microarray;Other 15685193
MIRT021231 hsa-miR-146a-5p Other 20375304
MIRT023390 hsa-miR-122-5p Microarray 17612493
MIRT024870 hsa-miR-215-5p Microarray 19074876
Transcription factors Transcription factors information provided by TRRUST V2 database.
6
Transcription factor Regulation Reference
NFKB1 Activation 19164127
NFKB1 Unknown 12182451
PPARG Activation 15356156
RELA Activation 19164127
SP1 Unknown 12182451
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 20374249, 32296183
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 8422464, 9310491
GO:0006952 Process Defense response TAS 1378080
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604534 1703 ENSG00000112149
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q01151
Protein name CD83 antigen (hCD83) (B-cell activation protein) (Cell surface protein HB15) (CD antigen CD83)
Protein function Transmembrane glycoprotein predominantly found on the surface of many immune cells including dendritic cells or lymphocytes that plays various roles in immune response regulation. Plays an essential role in CD4(+) T-selection, differentiation an
PDB 5MIX , 5MJ0 , 5MJ1 , 5MJ2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 19 127 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed by activated lymphocytes, Langerhans cells and activatd dendritic cells. {ECO:0000269|PubMed:11922761}.
Sequence
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERM
ETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSG
KVILRVT
GCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGM
ERAFLPVTSPNKHLGLVTPHKTELV
Sequence length 205
Interactions View interactions