Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	928
Gene name Gene Name - the full gene name approved by the HGNC.	CD9 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD9
Synonyms (NCBI Gene) Gene synonyms aliases	BTCC-1, DRAP-27, MIC3, MRP-1, TSPAN-29, TSPAN29
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded p

Show/Hide all(141)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018296	hsa-miR-335-5p	Microarray	18185580
MIRT019530	hsa-miR-326	Western blot;qRT-PCR	19883630
MIRT876423	hsa-miR-1283	CLIP-seq
MIRT876424	hsa-miR-1286	CLIP-seq
MIRT876425	hsa-miR-3149	CLIP-seq
MIRT876426	hsa-miR-3167	CLIP-seq
MIRT876427	hsa-miR-330-3p	CLIP-seq
MIRT876428	hsa-miR-338-5p	CLIP-seq
MIRT876429	hsa-miR-3655	CLIP-seq
MIRT876430	hsa-miR-3908	CLIP-seq
MIRT876431	hsa-miR-3924	CLIP-seq
MIRT876432	hsa-miR-3942-5p	CLIP-seq
MIRT876433	hsa-miR-4317	CLIP-seq
MIRT876434	hsa-miR-4703-5p	CLIP-seq
MIRT876435	hsa-miR-4722-5p	CLIP-seq
MIRT876436	hsa-miR-4766-3p	CLIP-seq
MIRT876437	hsa-miR-4775	CLIP-seq
MIRT876438	hsa-miR-4795-3p	CLIP-seq
MIRT876439	hsa-miR-511	CLIP-seq
MIRT876440	hsa-miR-518d-5p	CLIP-seq
MIRT876441	hsa-miR-519b-5p	CLIP-seq
MIRT876442	hsa-miR-519c-5p	CLIP-seq
MIRT876443	hsa-miR-520c-5p	CLIP-seq
MIRT876444	hsa-miR-526a	CLIP-seq
MIRT876445	hsa-miR-544	CLIP-seq
MIRT876446	hsa-miR-548p	CLIP-seq
MIRT876447	hsa-miR-548u	CLIP-seq
MIRT876448	hsa-miR-561	CLIP-seq
MIRT876449	hsa-miR-590-3p	CLIP-seq
MIRT876450	hsa-miR-876-5p	CLIP-seq
MIRT876424	hsa-miR-1286	CLIP-seq
MIRT876426	hsa-miR-3167	CLIP-seq
MIRT876428	hsa-miR-338-5p	CLIP-seq
MIRT876429	hsa-miR-3655	CLIP-seq
MIRT876431	hsa-miR-3924	CLIP-seq
MIRT1556156	hsa-miR-410	CLIP-seq
MIRT876433	hsa-miR-4317	CLIP-seq
MIRT1556157	hsa-miR-4720-3p	CLIP-seq
MIRT876435	hsa-miR-4722-5p	CLIP-seq
MIRT1556158	hsa-miR-4804-3p	CLIP-seq
MIRT876440	hsa-miR-518d-5p	CLIP-seq
MIRT876441	hsa-miR-519b-5p	CLIP-seq
MIRT876442	hsa-miR-519c-5p	CLIP-seq
MIRT876443	hsa-miR-520c-5p	CLIP-seq
MIRT876444	hsa-miR-526a	CLIP-seq
MIRT876445	hsa-miR-544	CLIP-seq
MIRT876446	hsa-miR-548p	CLIP-seq
MIRT876450	hsa-miR-876-5p	CLIP-seq
MIRT1556159	hsa-miR-889	CLIP-seq
MIRT876423	hsa-miR-1283	CLIP-seq
MIRT1959730	hsa-miR-142-5p	CLIP-seq
MIRT876428	hsa-miR-338-5p	CLIP-seq
MIRT876429	hsa-miR-3655	CLIP-seq
MIRT876430	hsa-miR-3908	CLIP-seq
MIRT876431	hsa-miR-3924	CLIP-seq
MIRT876432	hsa-miR-3942-5p	CLIP-seq
MIRT876433	hsa-miR-4317	CLIP-seq
MIRT876434	hsa-miR-4703-5p	CLIP-seq
MIRT876436	hsa-miR-4766-3p	CLIP-seq
MIRT1959731	hsa-miR-4803	CLIP-seq
MIRT876440	hsa-miR-518d-5p	CLIP-seq
MIRT876441	hsa-miR-519b-5p	CLIP-seq
MIRT876442	hsa-miR-519c-5p	CLIP-seq
MIRT876443	hsa-miR-520c-5p	CLIP-seq
MIRT876444	hsa-miR-526a	CLIP-seq
MIRT1959732	hsa-miR-548a-5p	CLIP-seq
MIRT1959733	hsa-miR-548ab	CLIP-seq
MIRT1959734	hsa-miR-548ak	CLIP-seq
MIRT1959735	hsa-miR-548b-5p	CLIP-seq
MIRT1959736	hsa-miR-548c-5p	CLIP-seq
MIRT1959737	hsa-miR-548d-5p	CLIP-seq
MIRT1959738	hsa-miR-548h	CLIP-seq
MIRT1959739	hsa-miR-548i	CLIP-seq
MIRT1959740	hsa-miR-548j	CLIP-seq
MIRT1959741	hsa-miR-548k	CLIP-seq
MIRT1959742	hsa-miR-548l	CLIP-seq
MIRT876446	hsa-miR-548p	CLIP-seq
MIRT876447	hsa-miR-548u	CLIP-seq
MIRT1959743	hsa-miR-548w	CLIP-seq
MIRT1959744	hsa-miR-548y	CLIP-seq
MIRT1959745	hsa-miR-559	CLIP-seq
MIRT2196782	hsa-miR-1224-3p	CLIP-seq
MIRT2196783	hsa-miR-1260	CLIP-seq
MIRT2196784	hsa-miR-1260b	CLIP-seq
MIRT2196785	hsa-miR-1266	CLIP-seq
MIRT2196786	hsa-miR-1280	CLIP-seq
MIRT876424	hsa-miR-1286	CLIP-seq
MIRT1959730	hsa-miR-142-5p	CLIP-seq
MIRT2196787	hsa-miR-3074-5p	CLIP-seq
MIRT2196788	hsa-miR-3124-3p	CLIP-seq
MIRT876425	hsa-miR-3149	CLIP-seq
MIRT876426	hsa-miR-3167	CLIP-seq
MIRT876428	hsa-miR-338-5p	CLIP-seq
MIRT876429	hsa-miR-3655	CLIP-seq
MIRT2196789	hsa-miR-370	CLIP-seq
MIRT876430	hsa-miR-3908	CLIP-seq
MIRT876431	hsa-miR-3924	CLIP-seq
MIRT876432	hsa-miR-3942-5p	CLIP-seq
MIRT1556156	hsa-miR-410	CLIP-seq
MIRT2196790	hsa-miR-4270	CLIP-seq
MIRT876433	hsa-miR-4317	CLIP-seq
MIRT2196791	hsa-miR-4441	CLIP-seq
MIRT2196792	hsa-miR-4518	CLIP-seq
MIRT2196793	hsa-miR-4668-3p	CLIP-seq
MIRT876434	hsa-miR-4703-5p	CLIP-seq
MIRT1556157	hsa-miR-4720-3p	CLIP-seq
MIRT876435	hsa-miR-4722-5p	CLIP-seq
MIRT876436	hsa-miR-4766-3p	CLIP-seq
MIRT1959731	hsa-miR-4803	CLIP-seq
MIRT1556158	hsa-miR-4804-3p	CLIP-seq
MIRT876440	hsa-miR-518d-5p	CLIP-seq
MIRT876441	hsa-miR-519b-5p	CLIP-seq
MIRT876442	hsa-miR-519c-5p	CLIP-seq
MIRT876443	hsa-miR-520c-5p	CLIP-seq
MIRT876444	hsa-miR-526a	CLIP-seq
MIRT876445	hsa-miR-544	CLIP-seq
MIRT1959732	hsa-miR-548a-5p	CLIP-seq
MIRT1959733	hsa-miR-548ab	CLIP-seq
MIRT1959734	hsa-miR-548ak	CLIP-seq
MIRT1959735	hsa-miR-548b-5p	CLIP-seq
MIRT2196794	hsa-miR-548c-3p	CLIP-seq
MIRT1959736	hsa-miR-548c-5p	CLIP-seq
MIRT1959737	hsa-miR-548d-5p	CLIP-seq
MIRT1959738	hsa-miR-548h	CLIP-seq
MIRT1959739	hsa-miR-548i	CLIP-seq
MIRT1959740	hsa-miR-548j	CLIP-seq
MIRT1959741	hsa-miR-548k	CLIP-seq
MIRT1959742	hsa-miR-548l	CLIP-seq
MIRT876446	hsa-miR-548p	CLIP-seq
MIRT1959743	hsa-miR-548w	CLIP-seq
MIRT1959744	hsa-miR-548y	CLIP-seq
MIRT2196795	hsa-miR-555	CLIP-seq
MIRT1959745	hsa-miR-559	CLIP-seq
MIRT876448	hsa-miR-561	CLIP-seq
MIRT2196796	hsa-miR-605	CLIP-seq
MIRT2196797	hsa-miR-767-3p	CLIP-seq
MIRT876450	hsa-miR-876-5p	CLIP-seq
MIRT1556159	hsa-miR-889	CLIP-seq
MIRT876423	hsa-miR-1283	CLIP-seq
MIRT876427	hsa-miR-330-3p	CLIP-seq
MIRT876427	hsa-miR-330-3p	CLIP-seq

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005178	Function	Integrin binding	IDA	12796480, 27993971
GO:0005178	Function	Integrin binding	IEA
GO:0005515	Function	Protein binding	IPI	11278880, 11504738, 12796480, 15344881, 18541721, 23091066, 23289620, 23858057, 26686862, 30833792, 32296183, 35271311
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	NAS	2037603, 6198179
GO:0005886	Component	Plasma membrane	TAS	1840589
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007155	Process	Cell adhesion	IDA	7511626
GO:0007155	Process	Cell adhesion	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IDA	14575715
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008347	Process	Glial cell migration	IMP	26224160
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0014905	Process	Myoblast fusion involved in skeletal muscle regeneration	IEA
GO:0014905	Process	Myoblast fusion involved in skeletal muscle regeneration	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016324	Component	Apical plasma membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030168	Process	Platelet activation	NAS	2037603
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030913	Process	Paranodal junction assembly	IEA
GO:0030913	Process	Paranodal junction assembly	ISS
GO:0031092	Component	Platelet alpha granule membrane	TAS
GO:0031623	Process	Receptor internalization	IEA
GO:0031623	Process	Receptor internalization	ISS
GO:0032991	Component	Protein-containing complex	IDA	15344881
GO:0035036	Process	Sperm-egg recognition	IEA
GO:0035036	Process	Sperm-egg recognition	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070062	Component	Extracellular exosome	IDA	15326289, 15908444
GO:0070062	Component	Extracellular exosome	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0090331	Process	Negative regulation of platelet aggregation	IDA	18541721
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:1905521	Process	Regulation of macrophage migration	IEA

MIM	HGNC	e!Ensembl
143030	1709	ENSG00000010278

Protein

UniProt ID

P21926

Protein name

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Protein function

Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion (PubMed:14575715, PubMed:18541721, PubMed:8478605). Present at the cell su

PDB

6K4J , 6RLO , 6RLR , 6Z1V , 6Z20

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	10 → 220	Tetraspanin family	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in platelets (at protein level) (PubMed:19640571). Expressed by a variety of hematopoietic and epithelial cells (PubMed:19640571). {ECO:0000269|PubMed:19640571}.

Sequence

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV
YILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKE
VQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKS
CPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

Sequence length

228

Interactions

View interactions

	KEGG		Reactome
	Virion - Hepatitis viruses Hematopoietic cell lineage		Platelet degranulation Acrosome Reaction and Sperm:Oocyte Membrane Binding Uptake and function of diphtheria toxin

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (105)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute On Chronic Liver Failure	Associate	35330909
Adenocarcinoma	Associate	20543560, 22613496
Arthritis Rheumatoid	Associate	36826611
Asthenozoospermia	Associate	23174138
Atherosclerosis	Associate	9396739
Autoimmune Diseases	Associate	39212542
Bernard Soulier Syndrome	Associate	19459130
beta Thalassemia	Associate	17178667, 31399060, 32278313
Blood Platelet Disorders	Associate	1840589
Bone Marrow Diseases	Associate	19604240
Breast Neoplasms	Associate	22791584, 25103498, 9736046
Breast Neoplasms	Inhibit	29462126
Burkitt Lymphoma	Associate	9737661
Carcinogenesis	Associate	35563166
Carcinoma Embryonal	Associate	17970049
Carcinoma Hepatocellular	Associate	22577054, 38287800
Carcinoma Hepatocellular	Inhibit	32350244
Carcinoma Merkel Cell	Associate	20118909
Carcinoma Pancreatic Ductal	Associate	35622458
Carcinoma Papillary	Associate	14534881
Cardiovascular Diseases	Associate	32245320
Cartilage Diseases	Associate	15380042
Charcot Marie Tooth Disease	Associate	19657941
Colorectal Neoplasms	Associate	12838318, 22895844, 25301083, 32589377, 36172359
COVID 19	Associate	35866369
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	24201754
Drug Related Side Effects and Adverse Reactions	Associate	34469729
Epidermodysplasia Verruciformis	Associate	33218198, 35012489
Esophageal Squamous Cell Carcinoma	Associate	10098753
Esophageal Squamous Cell Carcinoma	Stimulate	26045817
Fibrosarcoma	Associate	10427099, 23840773
Gallbladder Diseases	Associate	22613496
Gastrointestinal Stromal Tumors	Associate	21244575, 24133347
Glaucoma	Inhibit	31680442
Glioblastoma	Associate	37938214
Glucagonoma	Associate	23840773
Glucosephosphate Dehydrogenase Deficiency	Associate	11739177
Hepatitis C	Associate	22577054
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30678441
Histiocytosis Langerhans Cell	Associate	35231481
HIV Infections	Associate	18036256, 37404829
Hypoxia	Inhibit	31407387, 34907783
Hypoxia	Stimulate	34181359
Infections	Associate	22577054, 32385608
Infections	Stimulate	37404829, 7545080
Inflammation	Associate	32245320
Leukemia	Associate	17852453, 24699135, 30740913, 7657811
Leukemia Lymphocytic Chronic B Cell	Associate	25833959
Leukemia Myeloid Acute	Associate	12717686, 29720577, 30740913
Leukemia Promyelocytic Acute	Associate	25045197, 9734655
Lung Diseases Interstitial	Associate	10607488
Lung Neoplasms	Associate	32245320
Lupus Erythematosus Systemic	Associate	17083624, 21436623, 39212542
Lymphatic Metastasis	Associate	10098753, 24006899, 35563166
Lymphatic Metastasis	Inhibit	20060356
Lymphatic Metastasis	Stimulate	26045817, 30794730
Lymphedema	Associate	9920853
Lymphoma Large B Cell Diffuse	Associate	34745768
Lymphoma Non Hodgkin	Associate	34469729
Mast Cell Activation Disorders	Associate	7524750
Melanoma	Associate	11739177, 24412090, 34012515, 35563166
Melanoma Cutaneous Malignant	Associate	35563166
Mesothelioma	Associate	23128478
Mesothelioma Malignant	Associate	23128478
Mitochondrial Diseases	Associate	34012515
Monoclonal Gammopathy of Undetermined Significance	Associate	7545187
Mucopolysaccharidoses	Associate	32366041
Multiple Myeloma	Associate	10891455, 24788635
Myxoma	Associate	27179277
Neoplasm Metastasis	Inhibit	10098753, 24412090, 34012515, 35563166
Neoplasm Metastasis	Associate	23886139, 24133347, 26045817, 29884309
Neoplasms	Associate	10098753, 11739177, 14534881, 14735195, 17848953, 19211836, 20118909, 21036922, 22173169, 22427119, 25103498, 26015570, 26045817, 31048929, 32224528 View all (11 more)
Neoplasms	Stimulate	12838318
Neoplasms	Inhibit	16537545, 21244575
Neoplasms Cystic Mucinous and Serous	Associate	34469729
Neoplasms Germ Cell and Embryonal	Associate	17970049
Neurodegenerative Diseases	Associate	32319615
Osteoporosis	Associate	39778696
Ovarian Neoplasms	Associate	30678441
Pancreatic Neoplasms	Associate	16215274, 35622458
Pancreatitis	Associate	36671463
Papillary Thyroid Microcarcinoma	Associate	30794730
Parkinson Disease	Associate	33276480
Polycystic Ovary Syndrome	Inhibit	15820804
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	1840589, 29286918, 30740913, 32945456, 38037221
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	29286918
Primary Myelofibrosis	Associate	19604240, 25840601
Prostatic Neoplasms	Associate	17848953, 26036626, 32319557, 33569050
Prostatitis	Associate	32319557
Pulmonary Disease Chronic Obstructive	Associate	32245320
Purpura Thrombocytopenic Idiopathic	Inhibit	36202780
Respiratory Distress Syndrome	Associate	26507871
Retinoblastoma	Associate	37603355
Seminoma	Associate	17970049
Squamous Cell Carcinoma of Head and Neck	Associate	14735195, 23886139
Squamous Cell Carcinoma of Head and Neck	Inhibit	20060356
Stomach Neoplasms	Associate	12174360, 21521534
Stomach Ulcer	Associate	21521534
Testicular Germ Cell Tumor	Associate	17167184
Thalassemia	Associate	17178667
Thrombasthenia	Associate	8080982
Thrombosis	Associate	27179277
Urinary Bladder Neoplasms	Associate	14534881, 16103120
Virus Diseases	Associate	32385608
Vitamin D Deficiency	Associate	23128478

CD9 (CD9 molecule)