Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	926
Gene name Gene Name - the full gene name approved by the HGNC.	CD8 subunit beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD8B
Synonyms (NCBI Gene) Gene synonyms aliases	CD8B1, CD8beta, LEU2, LY3, LYT3, Ly-3, P37
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize an

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments
MIRT876404	hsa-miR-147	CLIP-seq
MIRT876405	hsa-miR-3650	CLIP-seq
MIRT876406	hsa-miR-3689a-3p	CLIP-seq
MIRT876407	hsa-miR-3689c	CLIP-seq
MIRT876408	hsa-miR-3911	CLIP-seq
MIRT876409	hsa-miR-3919	CLIP-seq
MIRT876410	hsa-miR-3921	CLIP-seq
MIRT876411	hsa-miR-4303	CLIP-seq
MIRT876412	hsa-miR-4455	CLIP-seq
MIRT876413	hsa-miR-4648	CLIP-seq
MIRT876414	hsa-miR-4653-5p	CLIP-seq
MIRT876415	hsa-miR-4654	CLIP-seq
MIRT876416	hsa-miR-4661-3p	CLIP-seq
MIRT876417	hsa-miR-4728-5p	CLIP-seq
MIRT876418	hsa-miR-4769-5p	CLIP-seq
MIRT876419	hsa-miR-593	CLIP-seq
MIRT876420	hsa-miR-609	CLIP-seq
MIRT876421	hsa-miR-642a	CLIP-seq
MIRT876422	hsa-miR-644	CLIP-seq
MIRT1959725	hsa-miR-3545-3p	CLIP-seq
MIRT1959726	hsa-miR-3925-3p	CLIP-seq
MIRT1959727	hsa-miR-4680-5p	CLIP-seq
MIRT1959728	hsa-miR-4685-5p	CLIP-seq
MIRT1959729	hsa-miR-766	CLIP-seq
MIRT2196778	hsa-miR-3183	CLIP-seq
MIRT2196779	hsa-miR-3667-5p	CLIP-seq
MIRT2196780	hsa-miR-4723-3p	CLIP-seq
MIRT2196781	hsa-miR-711	CLIP-seq
MIRT2499924	hsa-miR-1914	CLIP-seq
MIRT2499925	hsa-miR-218	CLIP-seq
MIRT2499926	hsa-miR-492	CLIP-seq
MIRT2499927	hsa-miR-636	CLIP-seq
MIRT2499924	hsa-miR-1914	CLIP-seq
MIRT2499925	hsa-miR-218	CLIP-seq
MIRT2499926	hsa-miR-492	CLIP-seq
MIRT2499927	hsa-miR-636	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
GATA3	Unknown	11937547
SATB1	Unknown	11937547

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0005515	Function	Protein binding	IPI	2493728
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	3145195
GO:0006955	Process	Immune response	NAS	11131152
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	NAS	9830036
GO:0009986	Component	Cell surface	IBA	21873635
GO:0015026	Function	Coreceptor activity	NAS	11131152
GO:0031901	Component	Early endosome membrane	TAS
GO:0042101	Component	T cell receptor complex	NAS	11131152
GO:0042110	Process	T cell activation	NAS	9830036
GO:0042288	Function	MHC class I protein binding	NAS	11131152
GO:0050690	Process	Regulation of defense response to virus by virus	TAS
GO:0050776	Process	Regulation of immune response	TAS

MIM	HGNC	e!Ensembl
186730	1707	ENSG00000172116

Protein

UniProt ID

P10966

Protein name

T-cell surface glycoprotein CD8 beta chain (CD antigen CD8b)

Protein function

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:p

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	24 → 135	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isofo

Sequence

MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQA
PSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVG
SPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGV
LVLLVSLGVAIHLCCRRRRARLRFMKQFYK

Sequence length

210

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules Antigen processing and presentation Hematopoietic cell lineage T cell receptor signaling pathway Yersinia infection Primary immunodeficiency		Nef Mediated CD8 Down-regulation Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Progressive Supranuclear Palsy	Progressive Supranuclear Palsy			GWAS

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	36281585
Breast Neoplasms	Associate	38263419
Carcinoma Renal Cell	Associate	35739510
Cardiovascular Diseases	Associate	32433748
Cognition Disorders	Associate	33324408
Conversion Disorder	Associate	33324408
Head and Neck Neoplasms	Associate	35090306
HIV Infections	Stimulate	26871709
Leukemia Lymphocytic Chronic B Cell	Associate	2459562
Leukemia Lymphoma Adult T Cell	Associate	9233579
Lymphoma Non Hodgkin	Associate	31343468
Lymphoma T Cell	Associate	37781365
Neoplasm Metastasis	Associate	36281585
Neoplasms	Associate	29022489, 32265897, 35588138, 36171009
Neoplasms	Inhibit	32350118
Osteoarthritis	Associate	33791375
Osteolysis	Associate	33791375
Papillomavirus Infections	Associate	35090306
Radial Ray Deficiency X Linked	Associate	2459562
Retinal Dysplasia	Associate	31343468
Schizophrenia	Associate	31211828
Sepsis	Associate	26871709
Stomatitis Aphthous	Inhibit	21478439
Uterine Cervical Neoplasms	Associate	35090306

CD8B (CD8 subunit beta)