Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
926
Gene name Gene Name - the full gene name approved by the HGNC.
CD8 subunit beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD8B
Synonyms (NCBI Gene) Gene synonyms aliases
CD8B1, CD8beta, LEU2, LY3, LYT3, Ly-3, P37
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize an
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT876404 hsa-miR-147 CLIP-seq
MIRT876405 hsa-miR-3650 CLIP-seq
MIRT876406 hsa-miR-3689a-3p CLIP-seq
MIRT876407 hsa-miR-3689c CLIP-seq
MIRT876408 hsa-miR-3911 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
GATA3 Unknown 11937547
SATB1 Unknown 11937547
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002250 Process Adaptive immune response NAS 17145893
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 2493728
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
186730 1707 ENSG00000172116
Protein
UniProt ID P10966
Protein name T-cell surface glycoprotein CD8 beta chain (CD antigen CD8b)
Protein function Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:p
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 24 135 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isofo
Sequence
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQA
PSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVG
SPELTFGKGTQLSVV
DFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGV
LVLLVSLGVAIHLCCRRRRARLRFMKQFYK
Sequence length 210
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
T cell receptor signaling pathway
Yersinia infection
Primary immunodeficiency
  Nef Mediated CD8 Down-regulation
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Progressive Supranuclear Palsy Progressive supranuclear palsy N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 36281585
Breast Neoplasms Associate 38263419
Carcinoma Renal Cell Associate 35739510
Cardiovascular Diseases Associate 32433748
Cognition Disorders Associate 33324408
Conversion Disorder Associate 33324408
Head and Neck Neoplasms Associate 35090306
HIV Infections Stimulate 26871709
Leukemia Lymphocytic Chronic B Cell Associate 2459562
Leukemia Lymphoma Adult T Cell Associate 9233579