Gene Gene information from NCBI Gene database.
Entrez ID 926
Gene name CD8 subunit beta
Gene symbol CD8B
Synonyms (NCBI Gene)
CD8B1CD8betaLEU2LY3LYT3Ly-3P37
Chromosome 2
Chromosome location 2p11.2
Summary The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize an
miRNA miRNA information provided by mirtarbase database.
36
miRTarBase ID miRNA Experiments Reference
MIRT876404 hsa-miR-147 CLIP-seq
MIRT876405 hsa-miR-3650 CLIP-seq
MIRT876406 hsa-miR-3689a-3p CLIP-seq
MIRT876407 hsa-miR-3689c CLIP-seq
MIRT876408 hsa-miR-3911 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
GATA3 Unknown 11937547
SATB1 Unknown 11937547
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002250 Process Adaptive immune response NAS 17145893
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 2493728
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
186730 1707 ENSG00000172116
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P10966
Protein name T-cell surface glycoprotein CD8 beta chain (CD antigen CD8b)
Protein function Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:p
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 24 135 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isofo
Sequence
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQA
PSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVG
SPELTFGKGTQLSVV
DFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGV
LVLLVSLGVAIHLCCRRRRARLRFMKQFYK
Sequence length 210
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
T cell receptor signaling pathway
Yersinia infection
Primary immunodeficiency
  Nef Mediated CD8 Down-regulation
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell