CD7 (CD7 molecule)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
924
Gene name Gene Name - the full gene name approved by the HGNC.
CD7 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD7
Synonyms (NCBI Gene) Gene synonyms aliases
GP40, LEU-9, TP41, Tp40
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lym
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
miRTarBase ID miRNA Experiments Reference
MIRT876146 hsa-miR-1207-5p CLIP-seq
MIRT876147 hsa-miR-18a CLIP-seq
MIRT876148 hsa-miR-18b CLIP-seq
MIRT876149 hsa-miR-3151 CLIP-seq
MIRT876150 hsa-miR-3622b-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane TAS 1695199, 3258561
GO:0006955 Process Immune response TAS 11485208
GO:0007169 Process Transmembrane receptor protein tyrosine kinase signaling pathway NAS 11485208
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
186820 1695 ENSG00000173762
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P09564
Protein name T-cell antigen CD7 (GP40) (T-cell leukemia antigen) (T-cell surface antigen Leu-9) (TP41) (CD antigen CD7)
Protein function Transmembrane glycoprotein expressed by T-cells and natural killer (NK) cells and their precursors (PubMed:7506726). Plays a costimulatory role in T-cell activation upon binding to its ligand K12/SECTM1 (PubMed:10652336). In turn, mediates the p
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 31 → 132 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on T-cells and natural killer (NK) cells and their precursors. {ECO:0000269|PubMed:1709867, ECO:0000269|PubMed:7506726}.
Sequence 
MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR
QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEV
NVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Sequence length 240
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  Hematopoietic cell lineage  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis, Familial rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)		 11796754
Lateral sclerosis AMYOTROPHIC LATERAL SCLEROSIS 1, Amyotrophic Lateral Sclerosis, Sporadic rs386134181, rs386134176, rs386134174, rs386134184, rs386134178, rs1693780539, rs1574698048 11796754
Show/Hide Text Mining Associations (99)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 20604962
Amyloidosis Associate 30497535
Anemia Associate 25637056
Anemia Hemolytic Autoimmune Associate 10583274
Anemia Refractory with Excess of Blasts Associate 12393641, 20662087
Angina Pectoris Inhibit 26823790
Arthritis Rheumatoid Inhibit 3048808
Arthritis Rheumatoid Associate 8621791
Autoimmune Diseases Associate 10583274
Carcinoma Renal Cell Associate 34002666