CD7 (CD7 molecule)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
924
Gene name Gene Name - the full gene name approved by the HGNC.
CD7 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD7
Synonyms (NCBI Gene) Gene synonyms aliases
GP40, LEU-9, TP41, Tp40
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lym
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(12)
miRTarBase ID miRNA Experiments Reference
MIRT876146 hsa-miR-1207-5p CLIP-seq
MIRT876147 hsa-miR-18a CLIP-seq
MIRT876148 hsa-miR-18b CLIP-seq
MIRT876149 hsa-miR-3151 CLIP-seq
MIRT876150 hsa-miR-3622b-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0002726 Process Positive regulation of T cell cytokine production IDA 10652336
GO:0004888 Function Transmembrane signaling receptor activity IDA 10652336
GO:0005515 Function Protein binding IPI 28514442, 32296183, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
186820 1695 ENSG00000173762
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID P09564
Protein name T-cell antigen CD7 (GP40) (T-cell leukemia antigen) (T-cell surface antigen Leu-9) (TP41) (CD antigen CD7)
Protein function Transmembrane glycoprotein expressed by T-cells and natural killer (NK) cells and their precursors (PubMed:7506726). Plays a costimulatory role in T-cell activation upon binding to its ligand K12/SECTM1 (PubMed:10652336). In turn, mediates the p
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 31 → 132 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on T-cells and natural killer (NK) cells and their precursors. {ECO:0000269|PubMed:1709867, ECO:0000269|PubMed:7506726}.
Sequence 
MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR
QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEV
NVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Sequence length 240
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG  
  Hematopoietic cell lineage  
<