PTTG1 (PTTG1 regulator of sister chromatid separation, securin)

Gene

• Entrez ID: 9232
• Gene name: PTTG1 regulator of sister chromatid separation, securin
• Gene symbol: PTTG1
• Synonyms (NCBI Gene): EAP1, ECRAR, HPTTG, PTTG, TUTR1
• Chromosome: 5
• Chromosome location: 5q33.3
• Summary: The encoded protein is a homolog of yeast securin proteins, which prevent separins from promoting sister chromatid separation. It is an anaphase-promoting complex (APC) substrate that associates with a separin until activation of the APC. The gene product

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052149	hsa-let-7b-5p	CLASH	23622248
MIRT050987	hsa-miR-17-5p	CLASH	23622248
MIRT050118	hsa-miR-26a-5p	CLASH	23622248
MIRT044923	hsa-miR-186-5p	CLASH	23622248
MIRT044427	hsa-miR-320a	CLASH	23622248
MIRT038103	hsa-miR-423-5p	CLASH	23622248
MIRT044923	hsa-miR-186-5p	Luciferase reporter assay	23671127
MIRT731822	hsa-miR-146a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27893422
MIRT731822	hsa-miR-146a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27893422
MIRT736622	hsa-miR-300	Luciferase reporter assay, qRT-PCR	33623402
MIRT736622	hsa-miR-300	Luciferase reporter assay, Western blotting, qRT-PCR	33624604

Transcription factors

Transcription factor	Regulation	Reference
KLF6	Repression	20116377;23977008
SP1	Activation	18339849
SP1	Unknown	14644503
TP53	Activation	12355087
TP53	Repression	15016801

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	NAS	12194817
GO:0005515	Function	Protein binding	IPI	12194817
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9811450
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9811450
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9811450
GO:0005829	Component	Cytosol	IDA	9811450
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007283	Process	Spermatogenesis	TAS	9915854
GO:0017124	Function	SH3 domain binding	IEA
GO:0045143	Process	Homologous chromosome segregation	IBA
GO:0051276	Process	Chromosome organization	IEA
GO:0051301	Process	Cell division	IEA
GO:0140677	Function	Molecular function activator activity	EXP	15929994

Other IDs

• MIM: 604147
• HGNC: 9690
• e!Ensembl: ENSG00000164611

Protein

• UniProt ID: O95997
• Protein name: Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)
• Protein function: Regulatory protein, which plays a central role in chromosome stability, in the p53/TP53 pathway, and DNA repair. Probably acts by blocking the action of key proteins. During the mitosis, it blocks Separase/ESPL1 function, preventing the proteoly
• PDB: 7NJ0, 7NJ1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04856	Securin	1 → 191	Securin sister-chromatid separation inhibitor	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at low level in most tissues, except in adult testis, where it is highly expressed. Overexpressed in many patients suffering from pituitary adenomas, primary epithelial neoplasias, and esophageal cancer. {ECO:0000269|PubMed:9
• Sequence:

  MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKAT
  RKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPF
  NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQ
  SPSSILSTLDVELPPVCCDIDI

• Sequence length: 202

Pathways

KEGG:

Cell cycle
Oocyte meiosis
Human T-cell leukemia virus 1 infection

Reactome:

APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Separation of Sister Chromatids