Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9197
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 33 member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC33A1
Synonyms (NCBI Gene) Gene synonyms aliases
ACATN, AT-1, AT1, CCHLND, HPBDS, SPG42
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q25.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is required for the formation of O-acetylated (Ac) gangliosides. The encoded protein is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Defects in this gene have
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs76440173 C>T Conflicting-interpretations-of-pathogenicity, likely-benign Coding sequence variant, missense variant, non coding transcript variant
rs1266904735 C>T Likely-pathogenic Splice donor variant, intron variant
rs1308995894 G>A,C Pathogenic Intron variant, coding sequence variant, synonymous variant, missense variant, stop gained, non coding transcript variant
rs1577455542 CATACTTACCTCAACAGC>- Pathogenic Splice donor variant, non coding transcript variant, intron variant, coding sequence variant
rs1577455897 C>T Pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018843 hsa-miR-335-5p Microarray 18185580
MIRT020990 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT028666 hsa-miR-30a-5p Proteomics 18668040
MIRT051368 hsa-let-7f-5p CLASH 23622248
MIRT454593 hsa-miR-3145-5p HITS-CLIP 23706177
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0005515 Function Protein binding IPI 35156780, 36012204
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IDA 20826464, 24828632
GO:0005789 Component Endoplasmic reticulum membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603690 95 ENSG00000169359
Protein
UniProt ID O00400
Protein name Acetyl-coenzyme A transporter 1 (AT-1) (Acetyl-CoA transporter 1) (Solute carrier family 33 member 1)
Protein function Acetyl-CoA transporter that mediates active acetyl-CoA import through the endoplasmic reticulum (ER) membrane into the ER lumen where specific ER-based acetyl-CoA:lysine acetyltransferases are responsible for the acetylation of ER-based protein
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13000 Acatn 74 289 Acetyl-coenzyme A transporter 1 Family
PF13000 Acatn 282 545 Acetyl-coenzyme A transporter 1 Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. With strongest signals in pancreas. {ECO:0000269|PubMed:9096318}.
Sequence
MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGD
FLKAPQSFRAELSSILLLLFLYVLQGIPLGLAGSIPLILQSKNVSYTDQAFFSFVFWPFS
LKLLWAPLVDAVYVKNFGRRKSWLVPTQYILGLFMIYLSTQVDRLLGNTDDRTPDVIALT
VAFFLFEFLAATQDIAVDGWALTMLSRENVGYASTCNSVGQTAGYFLGNVLFLALESADF
CNKYLRFQPQPRGIVTLSDFLFFWGTVFLITTTLVALLKKE
NEVSVVKEETQGITDTYKL
LFAIIKMPAVLTFCLLILTAKIGFSAADAVTGLKLVEEGVPKEHLALLAVPMVPLQIILP
LIISKYTAGPQPLNTFYKAMPYRLLLGLEYALLVWWTPKVEHQGGFPIYYYIVVLLSYAL
HQVTVYSMYVSIMAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECV
GASNQNCRTPDAVELCKKLGGSCVTALDGYYVESIICVFIGFGWWFFLGPKFKKLQDEGS
SSWKC
KRNN
Sequence length 549
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
  Transport of vitamins, nucleosides, and related molecules
Defective SLC33A1 causes spastic paraplegia 42 (SPG42)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hereditary spastic paraplegia Hereditary spastic paraplegia 42 rs121909484 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cataract Cataract N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cataract Associate 22243965
Familial apoceruloplasmin deficiency Associate 22243965
Genetic Diseases Inborn Associate 22243965
Hearing Loss Associate 22243965
Hepatolenticular Degeneration Associate 22243965
Menkes Kinky Hair Syndrome Associate 22243965
Spastic paraplegia 10 autosomal dominant Associate 19061983
Spastic Paraplegia 42 Autosomal Dominant Associate 19061983
Spastic Paraplegia Hereditary Associate 19061983, 20461110