Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9194
Gene name	Solute carrier family 16 member 7
Gene symbol	SLC16A7
Synonyms (NCBI Gene)	MCT2
Chromosome	12
Chromosome location	12q14.1
Summary	This gene is a member of the monocarboxylate transporter family. Members in this family transport metabolites, such as lactate, pyruvate, and ketone bodies. The protein encoded by this gene catalyzes the proton-linked transport of monocarboxylates and has

117

Show/Hide all (117)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024296	hsa-miR-215-5p	Microarray	19074876
MIRT026289	hsa-miR-192-5p	Microarray	19074876
MIRT467931	hsa-miR-4464	PAR-CLIP	23592263
MIRT467930	hsa-miR-4748	PAR-CLIP	23592263
MIRT467929	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT467928	hsa-miR-892c-5p	PAR-CLIP	23592263
MIRT467927	hsa-miR-506-5p	PAR-CLIP	23592263
MIRT467926	hsa-miR-759	PAR-CLIP	23592263
MIRT467925	hsa-miR-4729	PAR-CLIP	23592263
MIRT467924	hsa-miR-20a-3p	PAR-CLIP	23592263
MIRT467923	hsa-miR-496	PAR-CLIP	23592263
MIRT467922	hsa-miR-4423-3p	PAR-CLIP	23592263
MIRT467931	hsa-miR-4464	PAR-CLIP	23592263
MIRT467930	hsa-miR-4748	PAR-CLIP	23592263
MIRT467929	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT467928	hsa-miR-892c-5p	PAR-CLIP	23592263
MIRT467927	hsa-miR-506-5p	PAR-CLIP	23592263
MIRT467926	hsa-miR-759	PAR-CLIP	23592263
MIRT467925	hsa-miR-4729	PAR-CLIP	23592263
MIRT467924	hsa-miR-20a-3p	PAR-CLIP	23592263
MIRT467923	hsa-miR-496	PAR-CLIP	23592263
MIRT467922	hsa-miR-4423-3p	PAR-CLIP	23592263
MIRT1353213	hsa-miR-105	CLIP-seq
MIRT1353214	hsa-miR-1297	CLIP-seq
MIRT1353215	hsa-miR-132	CLIP-seq
MIRT1353216	hsa-miR-188-3p	CLIP-seq
MIRT1353217	hsa-miR-1915	CLIP-seq
MIRT1353218	hsa-miR-2053	CLIP-seq
MIRT1353219	hsa-miR-212	CLIP-seq
MIRT1353220	hsa-miR-224	CLIP-seq
MIRT1353221	hsa-miR-26a	CLIP-seq
MIRT1353222	hsa-miR-26b	CLIP-seq
MIRT1353223	hsa-miR-302a	CLIP-seq
MIRT1353224	hsa-miR-302b	CLIP-seq
MIRT1353225	hsa-miR-302c	CLIP-seq
MIRT1353226	hsa-miR-302d	CLIP-seq
MIRT1353227	hsa-miR-302e	CLIP-seq
MIRT1353228	hsa-miR-3145-3p	CLIP-seq
MIRT1353229	hsa-miR-3166	CLIP-seq
MIRT1353230	hsa-miR-331-5p	CLIP-seq
MIRT1353231	hsa-miR-372	CLIP-seq
MIRT1353232	hsa-miR-373	CLIP-seq
MIRT1353233	hsa-miR-409-3p	CLIP-seq
MIRT1353234	hsa-miR-4282	CLIP-seq
MIRT1353235	hsa-miR-4289	CLIP-seq
MIRT1353236	hsa-miR-4446-5p	CLIP-seq
MIRT1353237	hsa-miR-4465	CLIP-seq
MIRT1353238	hsa-miR-4726-3p	CLIP-seq
MIRT1353239	hsa-miR-4733-5p	CLIP-seq
MIRT1353240	hsa-miR-4735-5p	CLIP-seq
MIRT1353241	hsa-miR-4755-5p	CLIP-seq
MIRT1353242	hsa-miR-4769-3p	CLIP-seq
MIRT1353243	hsa-miR-4771	CLIP-seq
MIRT1353244	hsa-miR-4774-5p	CLIP-seq
MIRT1353245	hsa-miR-4799-5p	CLIP-seq
MIRT1353246	hsa-miR-499a-5p	CLIP-seq
MIRT1353247	hsa-miR-512-3p	CLIP-seq
MIRT1353248	hsa-miR-520a-3p	CLIP-seq
MIRT1353249	hsa-miR-520b	CLIP-seq
MIRT1353250	hsa-miR-520c-3p	CLIP-seq
MIRT1353251	hsa-miR-520d-3p	CLIP-seq
MIRT1353252	hsa-miR-520d-5p	CLIP-seq
MIRT1353253	hsa-miR-520e	CLIP-seq
MIRT1353254	hsa-miR-524-5p	CLIP-seq
MIRT1353255	hsa-miR-548c-3p	CLIP-seq
MIRT1353256	hsa-miR-7	CLIP-seq
MIRT1353257	hsa-miR-764	CLIP-seq
MIRT1353258	hsa-miR-944	CLIP-seq
MIRT2104570	hsa-miR-1246	CLIP-seq
MIRT2104571	hsa-miR-3122	CLIP-seq
MIRT2104572	hsa-miR-3607-5p	CLIP-seq
MIRT2104573	hsa-miR-3913-5p	CLIP-seq
MIRT2104574	hsa-miR-450b-3p	CLIP-seq
MIRT2104575	hsa-miR-490-5p	CLIP-seq
MIRT2104576	hsa-miR-769-3p	CLIP-seq
MIRT2623474	hsa-miR-1236	CLIP-seq
MIRT1353217	hsa-miR-1915	CLIP-seq
MIRT2623475	hsa-miR-200b	CLIP-seq
MIRT2623476	hsa-miR-200c	CLIP-seq
MIRT2623477	hsa-miR-3143	CLIP-seq
MIRT2623478	hsa-miR-3612	CLIP-seq
MIRT2623479	hsa-miR-3646	CLIP-seq
MIRT2623480	hsa-miR-3662	CLIP-seq
MIRT2623481	hsa-miR-3675-3p	CLIP-seq
MIRT2623482	hsa-miR-4263	CLIP-seq
MIRT2623483	hsa-miR-429	CLIP-seq
MIRT2623484	hsa-miR-4459	CLIP-seq
MIRT2623485	hsa-miR-4695-5p	CLIP-seq
MIRT2623486	hsa-miR-4698	CLIP-seq
MIRT1353238	hsa-miR-4726-3p	CLIP-seq
MIRT1353239	hsa-miR-4733-5p	CLIP-seq
MIRT1353242	hsa-miR-4769-3p	CLIP-seq
MIRT2623487	hsa-miR-495	CLIP-seq
MIRT2623488	hsa-miR-543	CLIP-seq
MIRT2623489	hsa-miR-548aa	CLIP-seq
MIRT2623490	hsa-miR-576-5p	CLIP-seq
MIRT2623491	hsa-miR-650	CLIP-seq
MIRT2623492	hsa-miR-665	CLIP-seq
MIRT2690902	hsa-miR-136	CLIP-seq
MIRT2623475	hsa-miR-200b	CLIP-seq
MIRT2623476	hsa-miR-200c	CLIP-seq
MIRT2690903	hsa-miR-3117-5p	CLIP-seq
MIRT2104571	hsa-miR-3122	CLIP-seq
MIRT2623477	hsa-miR-3143	CLIP-seq
MIRT2623479	hsa-miR-3646	CLIP-seq
MIRT2623480	hsa-miR-3662	CLIP-seq
MIRT2104573	hsa-miR-3913-5p	CLIP-seq
MIRT2690904	hsa-miR-410	CLIP-seq
MIRT2623482	hsa-miR-4263	CLIP-seq
MIRT2623483	hsa-miR-429	CLIP-seq
MIRT2104574	hsa-miR-450b-3p	CLIP-seq
MIRT2623486	hsa-miR-4698	CLIP-seq
MIRT2690905	hsa-miR-515-5p	CLIP-seq
MIRT2623488	hsa-miR-543	CLIP-seq
MIRT2623489	hsa-miR-548aa	CLIP-seq
MIRT2623490	hsa-miR-576-5p	CLIP-seq
MIRT2104576	hsa-miR-769-3p	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005477	Function	Pyruvate secondary active transmembrane transporter activity	TAS	9786900
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15505343, 32415067
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	IEA
GO:0015129	Function	Lactate transmembrane transporter activity	IBA
GO:0015129	Function	Lactate transmembrane transporter activity	IDA	9786900
GO:0015129	Function	Lactate transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IDA	32415067
GO:0015293	Function	Symporter activity	IEA
GO:0015355	Function	Secondary active monocarboxylate transmembrane transporter activity	IEA
GO:0015718	Process	Monocarboxylic acid transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035873	Process	Lactate transmembrane transport	IMP	9786900
GO:0035879	Process	Plasma membrane lactate transport	IBA
GO:0035879	Process	Plasma membrane lactate transport	IEA
GO:0042802	Function	Identical protein binding	IDA	32415067
GO:0050833	Function	Pyruvate transmembrane transporter activity	IDA	9786900, 32415067
GO:0055085	Process	Transmembrane transport	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417
GO:1901475	Process	Pyruvate transmembrane transport	IDA	9786900, 32415067

MIM	HGNC	e!Ensembl
603654	10928	ENSG00000118596

O60669

Protein name

Monocarboxylate transporter 2 (MCT 2) (Solute carrier family 16 member 7)

Protein function

Proton-coupled monocarboxylate symporter. Catalyzes the rapid transport across the plasma membrane of monocarboxylates such as L-lactate, pyruvate and ketone bodies, acetoacetate, beta-hydroxybutyrate and acetate (PubMed:32415067, PubMed:9786900

PDB

7BP3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	21 → 390	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in heart and in blood lymphocytes and monocytes (at protein level) (PubMed:15505343). High expression in testis, moderate to low in spleen, heart, kidney, pancreas, skeletal muscle, brain and leukocyte (PubMed:9786900). Restri

Sequence

MPPMPSAPPVHPPPDGGWGWIVVGAAFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAW
ISSIMLAVMYAGGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFIT
GLGLAFNLQPALTIIGKYFYRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLI
LGSLLLNACVAGSLMRPLGPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS
LFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEYSAAFLLSVMAFVDMFARPSV
GLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLGFGSVSSVLFE
TLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMYMSCGAIVVAASVW
LLIGNAINYRLLAKERKEENARQKTRESEPLSKSKHSEDVNVKVSNAQSVTSERETNI

Sequence length

478

Interactions

View interactions

	Reactome
			Proton-coupled monocarboxylate transport

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Hepatocellular carcinoma	Uncertain significance	rs140263110	RCV005932445

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	28644754
Adrenocortical Carcinoma	Associate	26587828
Autism Spectrum Disorder	Associate	23032108
Brain Neoplasms	Associate	22700320
Breast Neoplasms	Associate	21177384, 22700320, 25415228
Burkitt Lymphoma	Associate	9786900
Carcinoma Hepatocellular	Associate	25206282
Carcinoma Non Small Cell Lung	Associate	25578492
Carcinoma Ovarian Epithelial	Associate	37934721
Colorectal Neoplasms	Associate	18188595, 28874966, 29945573, 30521130
Diabetes Mellitus	Associate	36340268
Disease	Associate	25243493
Glioma	Associate	28092823
Glioma	Inhibit	40410718
Hereditary Breast and Ovarian Cancer Syndrome	Associate	20454640
Hypoxia	Associate	28092823
Hypoxia Brain	Stimulate	22700320
Infertility Male	Associate	24799634
Lung Neoplasms	Associate	35263597
Lymphoma Non Hodgkin	Associate	40410718
Mental Disorders	Associate	25243493
Mouth Diseases	Associate	21787388
Multiple Myeloma	Associate	26384349
Multiple Sclerosis	Associate	25206282
Myopathies Structural Congenital	Associate	35263597
N syndrome	Stimulate	29945573
Nasopharyngeal Carcinoma	Associate	35659152
Necrosis	Inhibit	30521130
Neoplasms	Associate	18188595, 20454640, 21787388, 25225794, 28092823, 30521130, 37522672, 40410718, 9786900
Oligospermia	Associate	24799634
Prostatic Neoplasms	Associate	21787388, 25639644, 26035357
Prostatitis	Associate	21787388, 25639644
Psychotic Disorders	Associate	25243493
Rhabdomyosarcoma	Associate	15997097
Urinary Bladder Neoplasms	Associate	40410718

SLC16A7 (solute carrier family 16 member 7)