Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
91833
Gene name Gene Name - the full gene name approved by the HGNC.
WD repeat domain 20
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WDR20
Synonyms (NCBI Gene) Gene synonyms aliases
Bun107, DMR
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a WD repeat-containing protein that functions to preserve and regulate the activity of the USP12-UAF1 deubiquitinating enzyme complex. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq,
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT697672 hsa-miR-5586-3p HITS-CLIP 23313552
MIRT697671 hsa-miR-4537 HITS-CLIP 23313552
MIRT069290 hsa-miR-19a-3p HITS-CLIP 22473208
MIRT069291 hsa-miR-19b-3p HITS-CLIP 22473208
MIRT697672 hsa-miR-5586-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19615732, 20147737, 25814554, 27373336, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IDA 30466959, 33844468
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
GO:0005737 Component Cytoplasm IDA 30466959, 33844468
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617741 19667 ENSG00000140153
Protein
UniProt ID Q8TBZ3
Protein name WD repeat-containing protein 20 (Protein DMR)
Protein function Regulator of deubiquitinating complexes. Activates deubiquitinating activity of complexes containing USP12 (PubMed:20147737, PubMed:27373336). Anchors at the base of the ubiquitin-contacting loop of USP12 and remotely modulates the catalytic cen
PDB 5K19 , 5K1C , 6JLQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 210 248 WD domain, G-beta repeat Repeat
PF00400 WD40 253 290 WD domain, G-beta repeat Repeat
Sequence
MATEGGGKEMNEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSQGSNPVRVSFVNLNDQSG
NGDRLCFNVGRELYFYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHLTATAESVSLLV
GFSAGQVQLIDPIKKETSKLFNEERLIDKSRVTCVKWVPGSESLFLVAHSSGNMYLYNVE
HTCGTTAPHYQLLKQGESFAVHTCKSKSTRNPLLKWTVGEGALNEFAFSPDGKFLACVSQ
DGFLRVFN
FDSVELHGTMKSYFGGLLCVCWSPDGKYIVTGGEDDLVTVWSFVDCRVIARG
HGHKSWVSVVAFDPYTTSVEEGDPMEFSGSDEDFQDLLHFGRDRANSTQSRLSKRNSTDS
RPVSVTYRFGSVGQDTQLCLWDLTEDILFPHQPLSRARTHTNVMNATSPPAGSNGNSVTT
PGNSVPPPLPRSNSLPHSAVSNAGSKSSVMDGAIASGVSKFATLSLHDRKERHHEKDHKR
NHSMGHISSKSSDKLNLVTKTKTDPAKTLGTPLCPRMEDVPLLEPLICKKIAHERLTVLI
FLEDCIVTACQEGFICTWGRPGKVVSFNP
Sequence length 569
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Ub-specific processing proteases
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Renal Cell Associate 26790128
Myotonic Dystrophy Associate 33844468
Neoplasms Associate 33844468
Prostatic Neoplasms Associate 26462181