UBXN11 (UBX domain protein 11)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
91544
Gene name Gene Name - the full gene name approved by the HGNC.
UBX domain protein 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
UBXN11
Synonyms (NCBI Gene) Gene synonyms aliases
COA-1, PP2243, SOC, SOCI, UBXD5
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with a divergent C-terminal UBX domain. The homologous protein in the rat interacts with members of the Rnd subfamily of Rho GTPases at the cell periphery through its C-terminal region. It also interacts with several heterotrim
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(26)
miRTarBase ID miRNA Experiments Reference
MIRT630875 hsa-miR-217 HITS-CLIP 23824327
MIRT630874 hsa-miR-6807-3p HITS-CLIP 23824327
MIRT630873 hsa-miR-1273g-3p HITS-CLIP 23824327
MIRT630872 hsa-miR-4286 HITS-CLIP 23824327
MIRT630871 hsa-miR-1470 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 21516116, 25416956, 29997244, 31515488, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0005856 Component Cytoskeleton IEA
GO:0043130 Function Ubiquitin binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609151 30600 ENSG00000158062
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q5T124
Protein name UBX domain-containing protein 11 (Colorectal tumor-associated antigen COA-1) (Socius) (UBX domain-containing protein 5)
Protein function May be involved in the reorganization of actin cytoskeleton mediated by RND1, RND2 and RND3. Promotes RHOA activation mediated by GNA12 and GNA13 (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08059 SEP 235 → 306 SEP domain Domain
PF00789 UBX 392 → 471 UBX domain Domain
Sequence 
MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIG
APVSRQVPASHDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAE
ATLQRQEELETMCVQLQRQVREMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERDWMTA
KKFWKPGDSLAPPEVDFDRLLASLQDLSELVVEGDTQVTPVPGGARLRTLEPIPLKLYRN
GIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNGVPFKVSDLRNQVYLEDGLDP
FPGEGRVVGRQLMHKALDRVEEHPGSRMTAEKFLNRLPKFVIRQGEVIDIRGPIRDTLQN
CCPLPARIQEIVVETPTLAAERERSQESPNTPAPPLSMLRIKSENGEQAFLLMMQPDNTI
GDVRALLAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRARRAPKSSLK
FSPGPCPGPGPGPSPGPGPGPSPGPGPGPSPCPGPSPSPQ
Sequence length 520
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dermatitis Atopic dermatitis N/A N/A GWAS
Gout Gout N/A N/A GWAS
Show/Hide Text Mining Associations (5)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Colonic Neoplasms Associate 14583468
Colorectal Neoplasms Associate 14583468, 25541970
Disease Associate 32678187
Infections Associate 32678187
Neoplasms Associate 14583468