UBXN11 (UBX domain protein 11)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 91544
Gene name UBX domain protein 11
Gene symbol UBXN11
Synonyms (NCBI Gene)
COA-1PP2243SOCSOCIUBXD5
Chromosome 1
Chromosome location 1p36.11
Summary This gene encodes a protein with a divergent C-terminal UBX domain. The homologous protein in the rat interacts with members of the Rnd subfamily of Rho GTPases at the cell periphery through its C-terminal region. It also interacts with several heterotrim
miRNA miRNA information provided by mirtarbase database.
26
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (26)
miRTarBase ID miRNA Experiments Reference
MIRT630875 hsa-miR-217 HITS-CLIP 23824327
MIRT630874 hsa-miR-6807-3p HITS-CLIP 23824327
MIRT630873 hsa-miR-1273g-3p HITS-CLIP 23824327
MIRT630872 hsa-miR-4286 HITS-CLIP 23824327
MIRT630871 hsa-miR-1470 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (6)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 21516116, 25416956, 29997244, 31515488, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0005856 Component Cytoskeleton IEA
GO:0043130 Function Ubiquitin binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
609151 30600 ENSG00000158062
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T124
Protein name UBX domain-containing protein 11 (Colorectal tumor-associated antigen COA-1) (Socius) (UBX domain-containing protein 5)
Protein function May be involved in the reorganization of actin cytoskeleton mediated by RND1, RND2 and RND3. Promotes RHOA activation mediated by GNA12 and GNA13 (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08059 SEP 235 → 306 SEP domain Domain
PF00789 UBX 392 → 471 UBX domain Domain
Sequence 
MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIG
APVSRQVPASHDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAE
ATLQRQEELETMCVQLQRQVREMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERDWMTA
KKFWKPGDSLAPPEVDFDRLLASLQDLSELVVEGDTQVTPVPGGARLRTLEPIPLKLYRN
GIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNGVPFKVSDLRNQVYLEDGLDP
FPGEGRVVGRQLMHKALDRVEEHPGSRMTAEKFLNRLPKFVIRQGEVIDIRGPIRDTLQN
CCPLPARIQEIVVETPTLAAERERSQESPNTPAPPLSMLRIKSENGEQAFLLMMQPDNTI
GDVRALLAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRARRAPKSSLK
FSPGPCPGPGPGPSPGPGPGPSPGPGPGPSPCPGPSPSPQ
Sequence length 520
Interactions View interactions