Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
915
Gene name Gene Name - the full gene name approved by the HGNC.
CD3 delta subunit of T-cell receptor complex
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD3D
Synonyms (NCBI Gene) Gene synonyms aliases
CD3-DELTA, CD3DELTA, IMD19, T3D
Disease Acronyms (UniProt) Disease acronyms from UniProt database
IMD19
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs111033580 G>A,T Pathogenic, likely-benign Synonymous variant, coding sequence variant, stop gained
rs111033581 G>T Pathogenic Stop gained, coding sequence variant, intron variant
rs730880296 C>T Pathogenic Intron variant
rs1591278347 C>T Pathogenic Coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT634780 hsa-miR-4530 HITS-CLIP 23824327
MIRT672316 hsa-miR-4645-5p HITS-CLIP 23824327
MIRT672315 hsa-miR-4673 HITS-CLIP 23824327
MIRT672314 hsa-miR-4755-3p HITS-CLIP 23824327
MIRT634779 hsa-miR-3622b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0004888 Function Transmembrane signaling receptor activity IBA 21873635
GO:0004888 Function Transmembrane signaling receptor activity IC 9485181
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm NAS 1831653
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
186790 1673 ENSG00000167286
Protein
UniProt ID P04234
Protein name T-cell surface glycoprotein CD3 delta chain (T-cell receptor T3 delta chain) (CD antigen CD3d)
Protein function Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell
PDB 1XIW , 6JXR , 7FJD , 7FJE , 7FJF , 7PHR , 8ES7 , 8ES8 , 8ES9 , 8JC0 , 8JCB , 8TW4 , 8TW6 , 8WXE , 8WY0 , 8WYI , 8YC0 , 9BBC , 9C3E , 9CI8 , 9CIA , 9CQ4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16680 Ig_4 30 104 T-cell surface glycoprotein CD3 delta chain Domain
PF02189 ITAM 146 165 Immunoreceptor tyrosine-based activation motif Motif
Tissue specificity TISSUE SPECIFICITY: CD3D is mostly present on T-lymphocytes with its TCR-CD3 partners. Present also in fetal NK-cells. {ECO:0000269|PubMed:1372642}.
Sequence
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDL
GKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATV
AGIIVTDVIATLLLAL
GVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Sequence length 171
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Chagas disease
Measles
Human T-cell leukemia virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Primary immunodeficiency
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Downstream TCR signaling
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
PD-1 signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Allergic Contact rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 17597826
Immunodeficiency IMMUNODEFICIENCY 19 rs1565678077, rs121908002, rs1421444086, rs1565688667, rs944235493, rs121918314, rs587776713, rs137852678, rs587776714, rs128620188, rs2147483647, rs1569556522, rs137853331, rs137853332, rs179363866
View all (256 more)
27807805, 25344390, 15546002, 23336327, 14602880, 22039266, 21926461, 24290291, 21883749
Severe combined immunodeficiency disease Severe Combined Immunodeficiency, T-B+ severe combined immunodeficiency due to CD3delta/CD3epsilon/CD3zeta rs886037607, rs118203993, rs121908714, rs121908739, rs121908740, rs121908735, rs121908721, rs121908722, rs121908156, rs1564414523, rs1564418254, rs1564446526, rs786205074, rs121908157, rs121908159
View all (197 more)
15546002
Unknown
Disease term Disease name Evidence References Source
Otitis media Otitis Media, Recurrent otitis media ClinVar
Coronary artery disease Coronary artery disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 32509861
Anemia Aplastic Stimulate 22401598
Arthritis Rheumatoid Associate 36311761
Brain Diseases Associate 29484035
Breast Neoplasms Associate 33350431, 34572592
Carcinoma Hepatocellular Inhibit 28258914
Carcinoma Hepatocellular Associate 37386390
Carcinoma Non Small Cell Lung Associate 26462029, 28587298
Cardiomyopathies Associate 21422001
Cardiomyopathy Dilated Associate 21422001, 36733486