CNOT9 (CCR4-NOT transcription complex subunit 9)

Gene

• Entrez ID: 9125
• Gene name: CCR4-NOT transcription complex subunit 9
• Gene symbol: CNOT9
• Synonyms (NCBI Gene): CAF40, CT129, RCD-1, RCD1, RQCD1
• Chromosome: 2
• Chromosome location: 2q35
• Summary: This gene encodes a member of the highly conserved RCD1 protein family. The encoded protein is a transcriptional cofactor and a core protein of the CCR4-NOT complex. It may be involved in signal transduction as well as retinoic acid-regulated cell differe

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs267599211	C>T	Likely-pathogenic	Coding sequence variant, intron variant, missense variant
rs1057519955	C>T	Likely-pathogenic	Missense variant, coding sequence variant, intron variant
rs1057519956	T>C	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1057519957	C>G	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000289	Process	Nuclear-transcribed mRNA poly(A) tail shortening	NAS	31320642
GO:0000932	Component	P-body	IBA
GO:0000932	Component	P-body	IEA
GO:0000932	Component	P-body	ISS
GO:0003713	Function	Transcription coactivator activity	IDA	18180299
GO:0005154	Function	Epidermal growth factor receptor binding	IPI	20878056
GO:0005515	Function	Protein binding	IPI	18180299, 18377426, 20878056, 24768540, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006402	Process	MRNA catabolic process	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0007548	Process	Sex differentiation	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0017148	Process	Negative regulation of translation	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019900	Function	Kinase binding	IPI	20878056
GO:0019904	Function	Protein domain specific binding	IPI	24768540
GO:0030014	Component	CCR4-NOT complex	IDA	19558367
GO:0030014	Component	CCR4-NOT complex	IEA
GO:0030014	Component	CCR4-NOT complex	NAS	19558367
GO:0030015	Component	CCR4-NOT core complex	IBA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0032991	Component	Protein-containing complex	IDA	20878056
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IMP	20878056
GO:0033147	Process	Negative regulation of intracellular estrogen receptor signaling pathway	IMP	16778766
GO:0042803	Function	Protein homodimerization activity	IDA	24768540
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IMP	20878056
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA

Other IDs

• MIM: 612054
• HGNC: 10445
• e!Ensembl: ENSG00000144580

Protein

• UniProt ID: Q92600
• Protein name: CCR4-NOT transcription complex subunit 9 (Cell differentiation protein RQCD1 homolog) (Rcd-1)
• Protein function: Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiati
• PDB: 2FV2, 4CRU, 4CRV, 4CT6, 4CT7, 5LSW, 5ONA, 5ONB, 6HOM, 6HON, 9FL8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04078	Rcd1	25 → 283		Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in spleen, thymus, prostate, testis, ovary and intestine. {ECO:0000269|PubMed:9447985}.
• Sequence:

  MHSLATAAPVPTTLAQVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSF
  GTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLY
  PFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKT
  VATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLS
  DNPRAREALRQCLPDQLKDTTFAQVLKDDTTTKRWLAQLVKNLQEGQVTDPRGIPLPPQ

• Sequence length: 299

Pathways

KEGG:

RNA degradation

Reactome:

Deadenylation of mRNA
TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

<