Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9125
Gene name Gene Name - the full gene name approved by the HGNC.	CCR4-NOT transcription complex subunit 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CNOT9
Synonyms (NCBI Gene) Gene synonyms aliases	CAF40, CT129, RCD-1, RCD1, RQCD1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q35
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the highly conserved RCD1 protein family. The encoded protein is a transcriptional cofactor and a core protein of the CCR4-NOT complex. It may be involved in signal transduction as well as retinoic acid-regulated cell differe

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs267599211	C>T	Likely-pathogenic	Coding sequence variant, intron variant, missense variant
rs1057519955	C>T	Likely-pathogenic	Missense variant, coding sequence variant, intron variant
rs1057519956	T>C	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1057519957	C>G	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000289	Process	Nuclear-transcribed mRNA poly(A) tail shortening	TAS
GO:0000932	Component	P-body	IBA	21873635
GO:0000932	Component	P-body	ISS
GO:0005154	Function	Epidermal growth factor receptor binding	IPI	20878056
GO:0005515	Function	Protein binding	IPI	18180299, 20878056, 24768540
GO:0005634	Component	Nucleus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS
GO:0007548	Process	Sex differentiation	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0017148	Process	Negative regulation of translation	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019900	Function	Kinase binding	IPI	20878056
GO:0019904	Function	Protein domain specific binding	IPI	24768540
GO:0030014	Component	CCR4-NOT complex	IDA	19558367
GO:0030015	Component	CCR4-NOT core complex	IBA	21873635
GO:0030374	Function	Nuclear receptor coactivator activity	IDA	18180299
GO:0031047	Process	Gene silencing by RNA	IEA
GO:0032991	Component	Protein-containing complex	IDA	20878056
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IMP	20878056
GO:0033147	Process	Negative regulation of intracellular estrogen receptor signaling pathway	IMP	16778766
GO:0042803	Function	Protein homodimerization activity	IDA	24768540
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IMP	20878056
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA

MIM	HGNC	e!Ensembl
612054	10445	ENSG00000144580

Protein

UniProt ID

Q92600

Protein name

CCR4-NOT transcription complex subunit 9 (Cell differentiation protein RQCD1 homolog) (Rcd-1)

Protein function

Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiati

PDB

2FV2 , 4CRU , 4CRV , 4CT6 , 4CT7 , 5LSW , 5ONA , 5ONB , 6HOM , 6HON , 9FL8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04078	Rcd1	25 → 283		Family

Tissue specificity

TISSUE SPECIFICITY: Detected in spleen, thymus, prostate, testis, ovary and intestine. {ECO:0000269|PubMed:9447985}.

Sequence

MHSLATAAPVPTTLAQVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSF
GTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLY
PFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKT
VATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLS
DNPRAREALRQCLPDQLKDTTFAQVLKDDTTTKRWLAQLVKNLQEGQVTDPRGIPLPPQ

Sequence length

299

Interactions

View interactions

	KEGG		Reactome
	RNA degradation		Deadenylation of mRNA TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Gastric cancer	Gastric Adenocarcinoma	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	26619011
Melanoma	Cutaneous Melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	26619011

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining
Developmental Disabilities	Associate	37092538
Diabetes Mellitus Type 2	Associate	31797865
Epilepsy	Associate	37092538
Facial Dysmorphism with Multiple Malformations	Associate	37092538
Hutchinson's Melanotic Freckle	Associate	25544760
Intellectual Disability	Associate	37092538
Melanoma	Associate	25544760
Melanoma Cutaneous Malignant	Associate	25544760
Mental Disorders	Associate	37092538
Muscle Hypotonia	Associate	37092538
Neoplasms	Associate	25544760
Seizures	Associate	37092538
Triple Negative Breast Neoplasms	Associate	29924958

CNOT9 (CCR4-NOT transcription complex subunit 9)