Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9101
Gene name	Ubiquitin specific peptidase 8
Gene symbol	USP8
Synonyms (NCBI Gene)	HumORF8PITA4SPG59UBPY
Chromosome	15
Chromosome location	15q21.2
Summary	This gene encodes a protein that belongs to the ubiquitin-specific processing protease family of proteins. The encoded protein is thought to regulate the morphology of the endosome by ubiquitination of proteins on this organelle and is involved in cargo s

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs672601306	TCC>-	Pathogenic	Inframe deletion, coding sequence variant
rs672601307	T>C	Pathogenic	Coding sequence variant, missense variant
rs672601308	C>G	Pathogenic	Coding sequence variant, missense variant
rs672601309	T>G	Pathogenic	Coding sequence variant, missense variant
rs672601310	A>G,T	Pathogenic	Coding sequence variant, missense variant
rs672601311	C>G,T	Pathogenic	Coding sequence variant, missense variant

174

Show/Hide all (174)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051165	hsa-miR-16-5p	CLASH	23622248
MIRT047051	hsa-miR-183-5p	CLASH	23622248
MIRT046085	hsa-miR-125b-5p	CLASH	23622248
MIRT044017	hsa-miR-374a-5p	CLASH	23622248
MIRT697725	hsa-miR-212-3p	HITS-CLIP	23313552
MIRT697724	hsa-miR-132-3p	HITS-CLIP	23313552
MIRT697722	hsa-miR-6768-3p	HITS-CLIP	23313552
MIRT697723	hsa-miR-4753-5p	HITS-CLIP	23313552
MIRT697721	hsa-miR-8066	HITS-CLIP	23313552
MIRT697720	hsa-miR-15a-3p	HITS-CLIP	23313552
MIRT510564	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT510563	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT510561	hsa-miR-4789-3p	PAR-CLIP	20371350
MIRT510562	hsa-miR-4643	PAR-CLIP	20371350
MIRT510560	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT510559	hsa-miR-466	PAR-CLIP	20371350
MIRT510564	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT510563	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT510561	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT510562	hsa-miR-4643	PAR-CLIP	23446348
MIRT510560	hsa-miR-95-5p	PAR-CLIP	23446348
MIRT510559	hsa-miR-466	PAR-CLIP	23446348
MIRT439320	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT439320	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT697725	hsa-miR-212-3p	HITS-CLIP	23313552
MIRT697724	hsa-miR-132-3p	HITS-CLIP	23313552
MIRT697722	hsa-miR-6768-3p	HITS-CLIP	23313552
MIRT697723	hsa-miR-4753-5p	HITS-CLIP	23313552
MIRT697721	hsa-miR-8066	HITS-CLIP	23313552
MIRT697720	hsa-miR-15a-3p	HITS-CLIP	23313552
MIRT510564	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT510563	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT510561	hsa-miR-4789-3p	PAR-CLIP	20371350
MIRT510562	hsa-miR-4643	PAR-CLIP	20371350
MIRT510560	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT510559	hsa-miR-466	PAR-CLIP	20371350
MIRT510564	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT510563	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT510561	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT510562	hsa-miR-4643	PAR-CLIP	23446348
MIRT510560	hsa-miR-95-5p	PAR-CLIP	23446348
MIRT510559	hsa-miR-466	PAR-CLIP	23446348
MIRT1480654	hsa-miR-1244	CLIP-seq
MIRT1480655	hsa-miR-1245b-3p	CLIP-seq
MIRT1480656	hsa-miR-146b-3p	CLIP-seq
MIRT1480657	hsa-miR-155	CLIP-seq
MIRT1480658	hsa-miR-19a	CLIP-seq
MIRT1480659	hsa-miR-19b	CLIP-seq
MIRT1480660	hsa-miR-302f	CLIP-seq
MIRT1480661	hsa-miR-3157-3p	CLIP-seq
MIRT1480662	hsa-miR-3168	CLIP-seq
MIRT1480663	hsa-miR-3173-5p	CLIP-seq
MIRT1480664	hsa-miR-339-5p	CLIP-seq
MIRT1480665	hsa-miR-3607-3p	CLIP-seq
MIRT1480666	hsa-miR-3646	CLIP-seq
MIRT1480667	hsa-miR-3682-3p	CLIP-seq
MIRT1480668	hsa-miR-3684	CLIP-seq
MIRT1480669	hsa-miR-3921	CLIP-seq
MIRT1480670	hsa-miR-3929	CLIP-seq
MIRT1480671	hsa-miR-4419b	CLIP-seq
MIRT1480672	hsa-miR-4446-5p	CLIP-seq
MIRT1480673	hsa-miR-4468	CLIP-seq
MIRT1480674	hsa-miR-4478	CLIP-seq
MIRT1480675	hsa-miR-4653-5p	CLIP-seq
MIRT1480676	hsa-miR-4682	CLIP-seq
MIRT1480677	hsa-miR-4686	CLIP-seq
MIRT1480678	hsa-miR-4755-5p	CLIP-seq
MIRT1480679	hsa-miR-4766-5p	CLIP-seq
MIRT1480680	hsa-miR-4771	CLIP-seq
MIRT1480681	hsa-miR-4777-5p	CLIP-seq
MIRT1480682	hsa-miR-499-3p	CLIP-seq
MIRT1480683	hsa-miR-499a-3p	CLIP-seq
MIRT1480684	hsa-miR-518d-5p	CLIP-seq
MIRT1480685	hsa-miR-519b-5p	CLIP-seq
MIRT1480686	hsa-miR-519c-5p	CLIP-seq
MIRT1480687	hsa-miR-520c-5p	CLIP-seq
MIRT1480688	hsa-miR-526a	CLIP-seq
MIRT1480689	hsa-miR-562	CLIP-seq
MIRT1480690	hsa-miR-616	CLIP-seq
MIRT1480691	hsa-miR-874	CLIP-seq
MIRT1480692	hsa-miR-944	CLIP-seq
MIRT1480693	hsa-miR-1263	CLIP-seq
MIRT1480694	hsa-miR-1291	CLIP-seq
MIRT1480695	hsa-miR-130a	CLIP-seq
MIRT1480696	hsa-miR-130b	CLIP-seq
MIRT1480656	hsa-miR-146b-3p	CLIP-seq
MIRT1480658	hsa-miR-19a	CLIP-seq
MIRT1480659	hsa-miR-19b	CLIP-seq
MIRT1480697	hsa-miR-203	CLIP-seq
MIRT1480698	hsa-miR-2052	CLIP-seq
MIRT1480699	hsa-miR-301a	CLIP-seq
MIRT1480700	hsa-miR-301b	CLIP-seq
MIRT1480660	hsa-miR-302f	CLIP-seq
MIRT1480701	hsa-miR-3074-3p	CLIP-seq
MIRT1480661	hsa-miR-3157-3p	CLIP-seq
MIRT1480663	hsa-miR-3173-5p	CLIP-seq
MIRT1480702	hsa-miR-328	CLIP-seq
MIRT1480703	hsa-miR-338-5p	CLIP-seq
MIRT1480664	hsa-miR-339-5p	CLIP-seq
MIRT1480704	hsa-miR-3591-5p	CLIP-seq
MIRT1480705	hsa-miR-3666	CLIP-seq
MIRT1480706	hsa-miR-376a	CLIP-seq
MIRT1480707	hsa-miR-376b	CLIP-seq
MIRT1480708	hsa-miR-382	CLIP-seq
MIRT1480709	hsa-miR-4295	CLIP-seq
MIRT1480710	hsa-miR-4422	CLIP-seq
MIRT1480711	hsa-miR-4426	CLIP-seq
MIRT1480672	hsa-miR-4446-5p	CLIP-seq
MIRT1480712	hsa-miR-4473	CLIP-seq
MIRT1480713	hsa-miR-4475	CLIP-seq
MIRT1480714	hsa-miR-454	CLIP-seq
MIRT1480715	hsa-miR-4647	CLIP-seq
MIRT1480716	hsa-miR-4662b	CLIP-seq
MIRT1480717	hsa-miR-4671-3p	CLIP-seq
MIRT1480718	hsa-miR-4694-3p	CLIP-seq
MIRT1480719	hsa-miR-4719	CLIP-seq
MIRT1480678	hsa-miR-4755-5p	CLIP-seq
MIRT1480681	hsa-miR-4777-5p	CLIP-seq
MIRT1480720	hsa-miR-496	CLIP-seq
MIRT1480682	hsa-miR-499-3p	CLIP-seq
MIRT1480683	hsa-miR-499a-3p	CLIP-seq
MIRT1480684	hsa-miR-518d-5p	CLIP-seq
MIRT1480685	hsa-miR-519b-5p	CLIP-seq
MIRT1480686	hsa-miR-519c-5p	CLIP-seq
MIRT1480687	hsa-miR-520c-5p	CLIP-seq
MIRT1480721	hsa-miR-522	CLIP-seq
MIRT1480688	hsa-miR-526a	CLIP-seq
MIRT1480722	hsa-miR-548u	CLIP-seq
MIRT1480723	hsa-miR-561	CLIP-seq
MIRT1480724	hsa-miR-587	CLIP-seq
MIRT1480690	hsa-miR-616	CLIP-seq
MIRT1480725	hsa-miR-664	CLIP-seq
MIRT1480691	hsa-miR-874	CLIP-seq
MIRT1480655	hsa-miR-1245b-3p	CLIP-seq
MIRT2144613	hsa-miR-1245b-5p	CLIP-seq
MIRT2144614	hsa-miR-132	CLIP-seq
MIRT2144615	hsa-miR-1323	CLIP-seq
MIRT2144616	hsa-miR-141	CLIP-seq
MIRT1480657	hsa-miR-155	CLIP-seq
MIRT2144617	hsa-miR-200a	CLIP-seq
MIRT2144618	hsa-miR-212	CLIP-seq
MIRT2144619	hsa-miR-27a	CLIP-seq
MIRT2144620	hsa-miR-27b	CLIP-seq
MIRT1480701	hsa-miR-3074-3p	CLIP-seq
MIRT2144621	hsa-miR-3142	CLIP-seq
MIRT2144622	hsa-miR-3148	CLIP-seq
MIRT2144623	hsa-miR-3156-3p	CLIP-seq
MIRT2144624	hsa-miR-345	CLIP-seq
MIRT1480667	hsa-miR-3682-3p	CLIP-seq
MIRT2144625	hsa-miR-374a	CLIP-seq
MIRT2144626	hsa-miR-374b	CLIP-seq
MIRT1480708	hsa-miR-382	CLIP-seq
MIRT2144627	hsa-miR-4301	CLIP-seq
MIRT1480711	hsa-miR-4426	CLIP-seq
MIRT2144628	hsa-miR-4435	CLIP-seq
MIRT2144629	hsa-miR-450b-5p	CLIP-seq
MIRT1480715	hsa-miR-4647	CLIP-seq
MIRT2144630	hsa-miR-4650-5p	CLIP-seq
MIRT1480716	hsa-miR-4662b	CLIP-seq
MIRT1480718	hsa-miR-4694-3p	CLIP-seq
MIRT2144631	hsa-miR-4703-3p	CLIP-seq
MIRT2144632	hsa-miR-4799-5p	CLIP-seq
MIRT1480682	hsa-miR-499-3p	CLIP-seq
MIRT1480683	hsa-miR-499a-3p	CLIP-seq
MIRT2144633	hsa-miR-513a-5p	CLIP-seq
MIRT1480721	hsa-miR-522	CLIP-seq
MIRT2144634	hsa-miR-532-3p	CLIP-seq
MIRT2144635	hsa-miR-548o	CLIP-seq
MIRT1480689	hsa-miR-562	CLIP-seq
MIRT2144636	hsa-miR-676	CLIP-seq
MIRT1480692	hsa-miR-944	CLIP-seq
MIRT1480708	hsa-miR-382	CLIP-seq
MIRT1480718	hsa-miR-4694-3p	CLIP-seq
MIRT1480721	hsa-miR-522	CLIP-seq

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000281	Process	Mitotic cytokinesis	IMP	18388320
GO:0002080	Component	Acrosomal membrane	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	9827704
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	16520378, 18388320, 18728397, 27444016
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS	9628861
GO:0005515	Function	Protein binding	IPI	15161933, 15778465, 17711858, 18329369, 19302785, 19427866, 24378640, 28514442, 33961781, 35271311, 36931259
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	18388320
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	16520378
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	16520378
GO:0005829	Component	Cytosol	IDA	27444016
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0007032	Process	Endosome organization	IBA
GO:0007032	Process	Endosome organization	IEA
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0007265	Process	Ras protein signal transduction	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	IMP	18388320
GO:0016579	Process	Protein deubiquitination	IMP	27302062
GO:0016787	Function	Hydrolase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0030496	Component	Midbody	IBA
GO:0030496	Component	Midbody	IDA	18388320
GO:0030496	Component	Midbody	IEA
GO:0031647	Process	Regulation of protein stability	IMP	27302062
GO:0032880	Process	Regulation of protein localization	IMP	27302062
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0061578	Function	K63-linked deubiquitinase activity	IDA	16520378
GO:0070536	Process	Protein K63-linked deubiquitination	IDA	16520378
GO:0071108	Process	Protein K48-linked deubiquitination	IDA	16520378
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	20495530
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099576	Process	Regulation of protein catabolic process at postsynapse, modulating synaptic transmission	IEA
GO:1905166	Process	Negative regulation of lysosomal protein catabolic process	IMP	27444016
GO:1905908	Process	Positive regulation of amyloid fibril formation	IMP	27444016
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990380	Function	K48-linked deubiquitinase activity	IDA	16520378

MIM	HGNC	e!Ensembl
603158	12631	ENSG00000138592

P40818

Protein name

Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.4.19.12) (Deubiquitinating enzyme 8) (Ubiquitin isopeptidase Y) (hUBPy) (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8)

Protein function

Hydrolase that can remove conjugated ubiquitin from proteins and therefore plays an important regulatory role at the level of protein turnover by preventing degradation. Converts both 'Lys-48' an 'Lys-63'-linked ubiquitin chains. Catalytic activ

PDB

1WHB , 2A9U , 2GFO , 2GWF , 3N3K , 6F09 , 8ADM , 8XPN , 8Y9A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08969	USP8_dimer	6 → 116	USP8 dimerisation domain	Domain
PF00581	Rhodanese	184 → 307	Rhodanese-like domain	Domain
PF00443	UCH	777 → 1106	Ubiquitin carboxyl-terminal hydrolase	Family

Sequence

MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEK
GAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLP
DDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDE
NIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEE
HRIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEK
ELRERQQEEQKEKLRKEEQEQKAKKKQEAEENEITEKQQKAKEEMEKKESEQAKKEDKET
SAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSG
KPFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGLPSGWAKFLD
PITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSP
DITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLR
NLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTG
QYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDH
LDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTS
KCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRW
KQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRW
FKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT

Sequence length

1118

Interactions

View interactions

	KEGG		Reactome
	Mitophagy - animal Endocytosis Cushing syndrome		Downregulation of ERBB2:ERBB3 signaling Regulation of FZD by ubiquitination Ub-specific processing proteases Negative regulation of MET activity

147

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Pituitary dependent hypercortisolism	Pathogenic	rs672601307, rs672601308, rs672601306, rs672601311	RCV000149417 RCV000149418 RCV000149416 RCV000149420

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
-	no classification for the single variant	rs672601309, rs672601310	-
Autosomal recessive spastic paraplegia type 59	Conflicting classifications of pathogenicity	rs148244041	RCV004765340
Hereditary spastic paraplegia	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	rs2051600642, rs762795803, rs1359249352, rs2141320965, rs1196856326, rs745444234, rs11638390, rs755591528, rs937524145, rs775130274, rs755050919, rs768167279, rs2141316371, rs1288098442, rs772655890 View all (115 more)	RCV001341214 RCV001348238 RCV001370618 RCV001415033 RCV001421989 RCV001497087 RCV001522628 RCV002003200 RCV001981784 RCV002004595 RCV001894769 RCV001926892 RCV001993947 RCV001978612 RCV001874863 RCV002013869 RCV001934338 RCV001889072 RCV001880873 RCV001875523 RCV001883586 RCV002027187 RCV002136910 RCV002135181 RCV002131003 RCV002124007 RCV002132490 RCV002117175 RCV002122260 RCV002118626 RCV002218779 RCV002105103 RCV002071817 RCV002160279 RCV002108514 RCV002132239 RCV002132358 RCV002139107 RCV003067338 RCV003063636 RCV003081208 RCV002581951 RCV002587949 RCV003122069 RCV002632108 RCV002640037 RCV002725829 RCV002742011 RCV002791222 RCV002843701 RCV002867115 RCV002926647 RCV002927408 RCV002933918 RCV002971231 RCV002952985 RCV002944106 RCV003057405 RCV003040732 RCV003534142 RCV003534178 RCV003534202 RCV003534228 RCV003534288 RCV003534235 RCV003531532 RCV003645993 RCV003646031 RCV003646013 RCV003646122 RCV003646279 RCV003646428 RCV003646438 RCV003646447 RCV003646604 RCV003646635 RCV003646789 RCV003646830 RCV003646845 RCV003646943 RCV003647084 RCV003647101 RCV003824106 RCV003842531 RCV003876093 RCV000532955 RCV000536150 RCV000559198 RCV000535635 RCV000542854 RCV000550889 RCV000557319 RCV000557543 RCV000633120 RCV000633121 RCV000633122 RCV000633119 RCV000633124 RCV000633123 RCV000633125 RCV000689968 RCV000700781 RCV000691735 RCV000798738 RCV000807610 RCV000815035 RCV000875327 RCV000874746 RCV000876098 RCV002064746 RCV001517106 RCV000872191 RCV000875024 RCV000871151 RCV000874042 RCV000876245 RCV000874525 RCV002548235 RCV000972040 RCV005092648 RCV000897089 RCV002548265 RCV005092919 RCV001431368 RCV001454764 RCV001069592 RCV001215011 RCV001205749 RCV001207175 RCV001213502 RCV001226138 RCV001246142 RCV001294286
USP8-related disorder	Uncertain significance; Benign; Likely benign	rs574030216, rs148200969, rs115970610, rs150245386, rs192977674, rs370876235	RCV003399819 RCV003901267 RCV003915496 RCV003955736 RCV003908313 RCV003942989

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
ACTH Secreting Pituitary Adenoma	Associate	25675982, 26701869, 28487882, 30093687, 31162547, 31222332, 31280266, 32652004, 34061962, 40544420
Adenocarcinoma	Stimulate	28544031
Adenocarcinoma in Situ	Associate	28544031
Adenocarcinoma of Lung	Associate	28544031
Adenoma	Associate	25675982, 31162547, 31280266, 39684405, 39684597
Adrenocortical Adenoma	Associate	26701869
Alzheimer Disease	Associate	40382655
Azoospermia	Associate	28975488
Breast Neoplasms	Associate	29626091, 31527799, 35361778, 35811497
Carcinoma Hepatocellular	Associate	37311739
Carcinoma Non Small Cell Lung	Associate	35658874
Carcinoma Renal Cell	Associate	37332045
Carcinoma Squamous Cell	Associate	30010158, 31705877
Cardiovascular Abnormalities	Associate	35205232
Combined Pituitary Hormone Deficiency	Associate	35029852
Crohn Disease	Associate	39684405
Cushing Syndrome	Associate	35029852
Drug Related Side Effects and Adverse Reactions	Associate	34674795
Genetic Diseases Inborn	Associate	31162547
Glioblastoma	Associate	20484045
Hypertension	Associate	35205232
Hypothyroidism	Associate	35029852
Infertility Male	Associate	28975488
Lung Neoplasms	Associate	30010158
Multiple Myeloma	Associate	22147262
Nelson Syndrome	Associate	35563252
Neoplasm Metastasis	Associate	35811497
Neoplasms	Associate	25675982, 28487882, 28544031, 30010158, 30093687, 31162547, 31222332, 35029852, 35361778, 35563252, 35658874, 35668434, 35811497, 37065760, 37639742, 39684597, 40544420 View all (2 more)
Oligospermia	Associate	28975488
Pancreatic Neoplasms	Associate	37639742
Parkinson Disease	Associate	37981592
Pituitary ACTH Hypersecretion	Associate	25675982, 25930709, 28487882, 28505279, 30093687, 31162547, 31222332, 33125691, 34489873, 34750505, 35029852, 35668434, 36123588, 39684405, 39684597
Pituitary Diseases	Associate	35029852
Pituitary Neoplasms	Associate	25675982, 25930709, 32652004, 34489873, 35668434, 40544420
Vitiligo	Associate	37287971

USP8 (ubiquitin specific peptidase 8)