STPG1 (sperm tail PG-rich repeat containing 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
90529
Gene name Gene Name - the full gene name approved by the HGNC.
Sperm tail PG-rich repeat containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STPG1
Synonyms (NCBI Gene) Gene synonyms aliases
C1orf201, MAPO2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(82)
miRTarBase ID miRNA Experiments Reference
MIRT019728 hsa-miR-375 Microarray 20215506
MIRT709825 hsa-miR-7851-3p HITS-CLIP 19536157
MIRT709824 hsa-miR-382-3p HITS-CLIP 19536157
MIRT709823 hsa-miR-3622a-3p HITS-CLIP 19536157
MIRT709822 hsa-miR-3622b-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005634 Component Nucleus IEA
GO:0005739 Component Mitochondrion IEA
GO:0043065 Process Positive regulation of apoptotic process IMP 23028632
GO:1902110 Process Positive regulation of mitochondrial membrane permeability involved in apoptotic process IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
615826 28070 ENSG00000001460
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q5TH74
Protein name O(6)-methylguanine-induced apoptosis 2 (MAPO2) (Sperm-tail PG-rich repeat-containing protein 1)
Protein function May positively contribute to the induction of apoptosis triggered by O(6)-methylguanine.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07004 SHIPPO-rpt 187 → 217 Sperm-tail PG-rich repeat Repeat
PF07004 SHIPPO-rpt 225 → 258 Sperm-tail PG-rich repeat Repeat
PF07004 SHIPPO-rpt 266 → 298 Sperm-tail PG-rich repeat Repeat
PF07004 SHIPPO-rpt 306 → 329 Sperm-tail PG-rich repeat Repeat
Sequence 
MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIPESEKKGFNSQAKRFP
HKKNDIPGPGFYNVIHQSPVSNSVSLSKKGTCMFPSMCARLDTIISKYPAANAYTIPSDF
ISKRDFSNSCSSMFQLPSFMKALKFETPAPNYYNASVSCCKQRNNVCTRAGFMSKTQRGS
FAFADKGPPPGHYDINESLVKQSPNTLMSCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVP
KKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPRKHFISSASFVSNTSRWTAA
PPQPGLPGPATYKPELPGKQSFLYNEDKKWIPVL
Sequence length 334
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Stomach Neoplasms Associate 35379170