STPG1 (sperm tail PG-rich repeat containing 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 90529
Gene name Sperm tail PG-rich repeat containing 1
Gene symbol STPG1
Synonyms (NCBI Gene)
C1orf201MAPO2
Chromosome 1
Chromosome location 1p36.11
miRNA miRNA information provided by mirtarbase database.
82
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (82)
miRTarBase ID miRNA Experiments Reference
MIRT019728 hsa-miR-375 Microarray 20215506
MIRT709825 hsa-miR-7851-3p HITS-CLIP 19536157
MIRT709824 hsa-miR-382-3p HITS-CLIP 19536157
MIRT709823 hsa-miR-3622a-3p HITS-CLIP 19536157
MIRT709822 hsa-miR-3622b-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion IEA
GO:0006915 Process Apoptotic process IEA
GO:0043065 Process Positive regulation of apoptotic process IMP 23028632
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
615826 28070 ENSG00000001460
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5TH74
Protein name O(6)-methylguanine-induced apoptosis 2 (MAPO2) (Sperm-tail PG-rich repeat-containing protein 1)
Protein function May positively contribute to the induction of apoptosis triggered by O(6)-methylguanine.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07004 SHIPPO-rpt 187 → 217 Sperm-tail PG-rich repeat Repeat
PF07004 SHIPPO-rpt 225 → 258 Sperm-tail PG-rich repeat Repeat
PF07004 SHIPPO-rpt 266 → 298 Sperm-tail PG-rich repeat Repeat
PF07004 SHIPPO-rpt 306 → 329 Sperm-tail PG-rich repeat Repeat
Sequence 
MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIPESEKKGFNSQAKRFP
HKKNDIPGPGFYNVIHQSPVSNSVSLSKKGTCMFPSMCARLDTIISKYPAANAYTIPSDF
ISKRDFSNSCSSMFQLPSFMKALKFETPAPNYYNASVSCCKQRNNVCTRAGFMSKTQRGS
FAFADKGPPPGHYDINESLVKQSPNTLMSCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVP
KKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPRKHFISSASFVSNTSRWTAA
PPQPGLPGPATYKPELPGKQSFLYNEDKKWIPVL
Sequence length 334
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Malignant tumor of urinary bladder Uncertain significance rs372257298 RCV005930912
Show/Hide Text Mining Associations (1)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Stomach Neoplasms Associate 35379170