Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9051
Gene name Gene Name - the full gene name approved by the HGNC.
Proline-serine-threonine phosphatase interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PSTPIP1
Synonyms (NCBI Gene) Gene synonyms aliases
AICZC, CD2BP1, CD2BP1L, CD2BP1S, H-PIP, PAPA, PAPAS, PSTPIP
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a cytoskeletal protein that is highly expressed in hemopoietic tissues. This protein functions via its interaction with several different proteins involved in cytoskeletal organization and inflammatory processes. It binds to the cytoplas
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28939089 G>A,C Pathogenic Non coding transcript variant, intron variant, missense variant, coding sequence variant
rs121908130 G>A Pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs201253322 C>G,T Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, genic downstream transcript variant, non coding transcript variant, missense variant
rs201872851 C>T Likely-benign, pathogenic, benign Coding sequence variant, missense variant, non coding transcript variant, 5 prime UTR variant
rs370782742 C>G,T Likely-benign, conflicting-interpretations-of-pathogenicity, benign Coding sequence variant, non coding transcript variant, synonymous variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT642578 hsa-miR-4713-5p HITS-CLIP 23824327
MIRT642577 hsa-miR-6867-3p HITS-CLIP 23824327
MIRT642576 hsa-miR-629-3p HITS-CLIP 23824327
MIRT736438 hsa-miR-491-3p qRT-PCR, Flow cytometry 33679688
MIRT642578 hsa-miR-4713-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001931 Component Uropod IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 9422760, 11971877, 16318909, 17964261, 18480402, 19807924, 21516116, 24407287, 25040622, 25416956, 25910212, 26871637, 32296183, 35152348
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606347 9580 ENSG00000140368
Protein
UniProt ID O43586
Protein name Proline-serine-threonine phosphatase-interacting protein 1 (PEST phosphatase-interacting protein 1) (CD2-binding protein 1) (H-PIP)
Protein function Involved in regulation of the actin cytoskeleton. May regulate WAS actin-bundling activity. Bridges the interaction between ABL1 and PTPN18 leading to ABL1 dephosphorylation. May play a role as a scaffold protein between PTPN12 and WAS and allow
PDB 2DIL , 7AAL , 7AAM , 7AAN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00611 FCH 21 93 Fes/CIP4, and EFC/F-BAR homology domain Family
PF00018 SH3_1 365 410 SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in the peripheral blood leukocytes, granulocytes and monocytes, namely in T-cells and natural killer cells, and in spleen. Weakly expressed in the thymus, small intestine, lung and placenta. {ECO:0000269|PubMed:1459502
Sequence
MMPQLQFKDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDMEELLRQRAQAEERYGKELVQI
ARKAGGQTEINSLRASFDSLKQQMENVGSSHIQ
LALTLREELRSLEEFRERQKEQRKKYE
AVMDRVQKSKLSLYKKAMESKKTYEQKCRDADDAEQAFERISANGHQKQVEKSQNKARQC
KDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTILRNALWVHSNQLSM
QCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEPPAPVPYQNYYDREVTPLTSSPG
IQPSCGMIKRFSGLLHGSPKTTSLAASAASTETLTPTPERNEGVYTAIAVQEIQGNPASP
AQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKL
Sequence length 416
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  NOD-like receptor signaling pathway   The NLRP3 inflammasome
Purinergic signaling in leishmaniasis infection
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Behcet Syndrome Behcet disease rs774164456 N/A
Pyogenic Arthritis, Pyoderma Gangrenosum And Acne pyogenic arthritis-pyoderma gangrenosum-acne syndrome rs28939089, rs121908130 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Autoinflammatory Disease Autoinflammatory syndrome, autoinflammatory syndrome N/A N/A ClinVar, GenCC
Diabetes Type 2 diabetes mellitus or coronary artery disease (pleiotropy) N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acne Vulgaris Associate 14595024, 24421327
Arthritis Associate 14595024, 34492165, 35152348
Arthritis Juvenile Associate 18576390
Arthropathy progressive pseudorheumatoid of childhood Associate 31858543
Behcet Syndrome Associate 28814775, 30808881
Cryopyrin Associated Periodic Syndromes Associate 35383566
Familial Mediterranean Fever Associate 14595024
Hearing Loss High Frequency Associate 26025129
Hereditary Autoinflammatory Diseases Associate 14595024, 18576390, 24421327, 26025129, 28814775, 30808881, 31286971, 33042144, 34399798, 34492165, 35152348, 36203570
Hidradenitis Suppurativa Associate 37013170