Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9049
Gene name Gene Name - the full gene name approved by the HGNC.
AHR interacting HSP90 co-chaperone
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AIP
Synonyms (NCBI Gene) Gene synonyms aliases
ARA9, FKBP16, FKBP37, PITA1, SMTPHN, XAP-2, XAP2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
PITA1
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. Th
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894190 G>A Pathogenic, conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance, drug-response Missense variant, coding sequence variant, 3 prime UTR variant
rs104894194 C>T Pathogenic Genic upstream transcript variant, upstream transcript variant, coding sequence variant, stop gained
rs104894195 C>G,T Pathogenic Missense variant, coding sequence variant, 3 prime UTR variant, stop gained
rs104895072 G>T Likely-pathogenic Coding sequence variant, synonymous variant
rs121908357 C>A,T Pathogenic-likely-pathogenic Synonymous variant, upstream transcript variant, coding sequence variant, genic upstream transcript variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT484297 hsa-miR-4779 PAR-CLIP 20371350
MIRT484298 hsa-miR-1321 PAR-CLIP 20371350
MIRT484296 hsa-miR-4739 PAR-CLIP 20371350
MIRT484295 hsa-miR-4756-5p PAR-CLIP 20371350
MIRT484294 hsa-miR-4738-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000413 Process Protein peptidyl-prolyl isomerization IEA
GO:0003713 Function Transcription coactivator activity TAS 9447995
GO:0003755 Function Peptidyl-prolyl cis-trans isomerase activity IEA
GO:0005515 Function Protein binding IPI 14557246, 17329248, 19375531, 20029029, 21170051, 21903422, 25036637, 28634279, 31980649
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605555 358 ENSG00000110711
Protein
UniProt ID O00170
Protein name AH receptor-interacting protein (AIP) (Aryl-hydrocarbon receptor-interacting protein) (HBV X-associated protein 2) (XAP-2) (Immunophilin homolog ARA9)
Protein function May play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting.; Cellular negative regulator of the hepatitis B virus (HBV) X protein.
PDB 2LKN , 4AIF , 4APO , 7ZUB , 8QMO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00254 FKBP_C 26 95 FKBP-type peptidyl-prolyl cis-trans isomerase Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Higher levels seen in the heart, placenta and skeletal muscle. Not expressed in the liver.
Sequence
MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPM
ELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHV
VLYPLVAKSLRNIAVGKDPLEGQRH
CCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVP
LIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQC
KLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAP
VVSRELQALEARIRQKDEEDKARFRGIFSH
Sequence length 330
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cushing syndrome
Chemical carcinogenesis - receptor activation
  Aryl hydrocarbon receptor signalling
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Degenerative polyarthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Cardiomyopathy Cardiomyopathies rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377
View all (900 more)
Cerebral palsy Cerebral Palsy rs121918149, rs75184679, rs730880264, rs587777428, rs797045067, rs767399782, rs564185858, rs886039513
Diabetes mellitus Diabetes Mellitus rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
Unknown
Disease term Disease name Evidence References Source
Acanthosis nigricans Acanthosis Nigricans ClinVar
Mental depression Depressive disorder ClinVar
Ptosis Blepharoptosis, Ptosis ClinVar
Pituitary Gigantism pituitary gigantism GenCC
Associations from Text Mining
Disease Name Relationship Type References
Abdominal Pain Associate 31125088
Acromegaly Associate 17360484, 17893251, 23300914, 25019383, 25075136, 27253664, 27650164, 28634279, 36757586, 36843582, 40500813
ACTH Secreting Pituitary Adenoma Associate 19556287
Adenocarcinoma Follicular Associate 32333269
Adenoma Associate 17244780, 17360484, 21450940, 29729370, 36843582, 37149543
Adenomatous Polyposis Coli Associate 21450940
Adrenal Gland Neoplasms Associate 19522821
Adrenocortical Carcinoma Associate 20454499
Atherosclerosis Associate 34580389, 37372394
Autoimmune Pancreatitis Associate 19940298