Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	90427
Gene name Gene Name - the full gene name approved by the HGNC.	Bcl2 modifying factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BMF
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q15.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL

Show/Hide all(112)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003394	hsa-miR-125b-5p	immunoblot, Luciferase reporter assay, qRT-PCR	19471102
MIRT003394	hsa-miR-125b-5p	Review	20029422
MIRT000141	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	19671867
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT822230	hsa-miR-1343	CLIP-seq
MIRT822231	hsa-miR-153	CLIP-seq
MIRT822232	hsa-miR-3119	CLIP-seq
MIRT822233	hsa-miR-4426	CLIP-seq
MIRT822234	hsa-miR-448	CLIP-seq
MIRT822235	hsa-miR-4534	CLIP-seq
MIRT822236	hsa-miR-4647	CLIP-seq
MIRT822237	hsa-miR-4662b	CLIP-seq
MIRT822238	hsa-miR-2467-3p	CLIP-seq
MIRT822239	hsa-miR-298	CLIP-seq
MIRT822240	hsa-miR-3064-3p	CLIP-seq
MIRT822241	hsa-miR-3158-5p	CLIP-seq
MIRT822242	hsa-miR-3678-3p	CLIP-seq
MIRT822243	hsa-miR-4493	CLIP-seq
MIRT822244	hsa-miR-4760-5p	CLIP-seq
MIRT1922597	hsa-miR-1200	CLIP-seq
MIRT1922598	hsa-miR-1976	CLIP-seq
MIRT1922599	hsa-miR-2467-5p	CLIP-seq
MIRT1922600	hsa-miR-3184	CLIP-seq
MIRT1922601	hsa-miR-3188	CLIP-seq
MIRT1922602	hsa-miR-3975	CLIP-seq
MIRT1922603	hsa-miR-423-5p	CLIP-seq
MIRT1922604	hsa-miR-4324	CLIP-seq
MIRT1922605	hsa-miR-4649-3p	CLIP-seq
MIRT1922606	hsa-miR-4688	CLIP-seq
MIRT1922607	hsa-miR-4723-5p	CLIP-seq
MIRT1922608	hsa-miR-4728-5p	CLIP-seq
MIRT1922609	hsa-miR-4736	CLIP-seq
MIRT1922610	hsa-miR-485-5p	CLIP-seq
MIRT1922611	hsa-miR-486-3p	CLIP-seq
MIRT1922612	hsa-miR-544b	CLIP-seq
MIRT1942999	hsa-miR-1207-3p	CLIP-seq
MIRT2181765	hsa-miR-1208	CLIP-seq
MIRT2181766	hsa-miR-1285	CLIP-seq
MIRT822230	hsa-miR-1343	CLIP-seq
MIRT2181767	hsa-miR-1915	CLIP-seq
MIRT2181768	hsa-miR-24	CLIP-seq
MIRT2181769	hsa-miR-29a	CLIP-seq
MIRT2181770	hsa-miR-29b	CLIP-seq
MIRT2181771	hsa-miR-29c	CLIP-seq
MIRT2181772	hsa-miR-3187-5p	CLIP-seq
MIRT2181773	hsa-miR-3189-5p	CLIP-seq
MIRT2181774	hsa-miR-3607-5p	CLIP-seq
MIRT2181775	hsa-miR-3611	CLIP-seq
MIRT2181776	hsa-miR-3616-3p	CLIP-seq
MIRT2181777	hsa-miR-3649	CLIP-seq
MIRT2181778	hsa-miR-3664-3p	CLIP-seq
MIRT2181779	hsa-miR-3667-3p	CLIP-seq
MIRT2181780	hsa-miR-3682-5p	CLIP-seq
MIRT2181781	hsa-miR-3691-3p	CLIP-seq
MIRT2181782	hsa-miR-409-3p	CLIP-seq
MIRT2181783	hsa-miR-4277	CLIP-seq
MIRT2181784	hsa-miR-4420	CLIP-seq
MIRT2181785	hsa-miR-4436b-3p	CLIP-seq
MIRT2181786	hsa-miR-4468	CLIP-seq
MIRT2181787	hsa-miR-4648	CLIP-seq
MIRT2181788	hsa-miR-4674	CLIP-seq
MIRT2181789	hsa-miR-4690-3p	CLIP-seq
MIRT2181790	hsa-miR-4709-3p	CLIP-seq
MIRT2181791	hsa-miR-4726-3p	CLIP-seq
MIRT2181792	hsa-miR-4758-3p	CLIP-seq
MIRT2181793	hsa-miR-4778-3p	CLIP-seq
MIRT2181794	hsa-miR-511	CLIP-seq
MIRT2181795	hsa-miR-520a-5p	CLIP-seq
MIRT2181796	hsa-miR-525-5p	CLIP-seq
MIRT2181797	hsa-miR-612	CLIP-seq
MIRT2181798	hsa-miR-760	CLIP-seq
MIRT822230	hsa-miR-1343	CLIP-seq
MIRT2181778	hsa-miR-3664-3p	CLIP-seq
MIRT2384791	hsa-miR-4685-5p	CLIP-seq
MIRT2435797	hsa-miR-1229	CLIP-seq
MIRT2441994	hsa-miR-1202	CLIP-seq
MIRT1942999	hsa-miR-1207-3p	CLIP-seq
MIRT2441995	hsa-miR-124	CLIP-seq
MIRT2441996	hsa-miR-15a	CLIP-seq
MIRT2441997	hsa-miR-15b	CLIP-seq
MIRT2441998	hsa-miR-16	CLIP-seq
MIRT2181767	hsa-miR-1915	CLIP-seq
MIRT2441999	hsa-miR-195	CLIP-seq
MIRT2442000	hsa-miR-205	CLIP-seq
MIRT2442001	hsa-miR-3194-5p	CLIP-seq
MIRT2442002	hsa-miR-3972	CLIP-seq
MIRT2442003	hsa-miR-421	CLIP-seq
MIRT2442004	hsa-miR-424	CLIP-seq
MIRT2442005	hsa-miR-4281	CLIP-seq
MIRT2442006	hsa-miR-4438	CLIP-seq
MIRT2442007	hsa-miR-4530	CLIP-seq
MIRT2442008	hsa-miR-4709-5p	CLIP-seq
MIRT2181791	hsa-miR-4726-3p	CLIP-seq
MIRT2442009	hsa-miR-497	CLIP-seq
MIRT2442010	hsa-miR-506	CLIP-seq
MIRT2442011	hsa-miR-548an	CLIP-seq
MIRT2442012	hsa-miR-642b	CLIP-seq
MIRT2181795	hsa-miR-520a-5p	CLIP-seq
MIRT2181796	hsa-miR-525-5p	CLIP-seq
MIRT2675997	hsa-miR-3657	CLIP-seq
MIRT2675998	hsa-miR-4302	CLIP-seq
MIRT2675999	hsa-miR-4669	CLIP-seq
MIRT2676000	hsa-miR-4676-5p	CLIP-seq
MIRT2676001	hsa-miR-4697-3p	CLIP-seq
MIRT2676002	hsa-miR-575	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11546872, 25416956, 26871637, 31515488, 32296183, 32814053
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0010507	Process	Negative regulation of autophagy	IBA
GO:0010507	Process	Negative regulation of autophagy	IDA	23629966
GO:0016459	Component	Myosin complex	IBA
GO:0016459	Component	Myosin complex	ISS	11546872
GO:0031334	Process	Positive regulation of protein-containing complex assembly	ISS
GO:0034644	Process	Cellular response to UV	IDA	23629966
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	19671867
GO:0043276	Process	Anoikis	IDA	11546872
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	ISS

MIM	HGNC	e!Ensembl
606266	24132	ENSG00000104081

Protein

UniProt ID

Q96LC9

Protein name

Bcl-2-modifying factor

Protein function

May play a role in apoptosis. Isoform 1 seems to be the main initiator.

PDB

7CNU , 8IQK , 8IQL , 8IQM , 8R58

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15185	BMF	1 → 184	Bcl-2-modifying factor, apoptosis	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells. {ECO:0000269|PubMed:14574334}.

Sequence

MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
PEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG
AGPR

Sequence length

184

Interactions

View interactions

	KEGG		Reactome
	MicroRNAs in cancer		BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members Activation of BMF and translocation to mitochondria

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Lymphocytic Leukemia	Chronic lymphocytic leukemia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	20431602
Calcinosis	Associate	30654331
Carcinoma Hepatocellular	Associate	19671867, 30468466
Carcinoma Pancreatic Ductal	Associate	37794108
Cholangiocarcinoma	Associate	35435120
Colorectal Neoplasms	Associate	25321483, 25955657, 35627268
Drug Related Side Effects and Adverse Reactions	Associate	20431602
Esophageal Squamous Cell Carcinoma	Associate	29749531
Glomerulosclerosis Focal Segmental	Associate	30709661
Hypoxia	Inhibit	20861305
Hypoxia Brain	Inhibit	20861305
Infarction	Associate	33546766
Leukemia Lymphocytic Chronic B Cell	Associate	27524613
Leukemia Myeloid Acute	Associate	35627268
Medulloblastoma	Associate	36273157
Melanoma	Associate	19244105
Multiple Myeloma	Associate	18354037
Neoplasms	Associate	22258404, 26181206, 28481029, 36273157
Neoplasms	Inhibit	33430890
Neuroblastoma	Associate	38014922

BMF (Bcl2 modifying factor)