Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	90390
Gene name Gene Name - the full gene name approved by the HGNC.	Mediator complex subunit 30
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MED30
Synonyms (NCBI Gene) Gene synonyms aliases	MED30S, THRAP6, TRAP25
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.11
Summary Summary of gene provided in NCBI Entrez Gene.	The multiprotein TRAP/Mediator complex facilitates gene expression through a wide variety of transcriptional activators. MED30 is a component of this complex that appears to be metazoan specific (Baek et al., 2002 [PubMed 11909976]).[supplied by OMIM, Nov

Show/Hide all(43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT450262	hsa-miR-5584-5p	PAR-CLIP	22100165
MIRT450263	hsa-miR-3126-5p	PAR-CLIP	22100165
MIRT450261	hsa-miR-6875-5p	PAR-CLIP	22100165
MIRT450260	hsa-miR-4419a	PAR-CLIP	22100165
MIRT450259	hsa-miR-4510	PAR-CLIP	22100165
MIRT450258	hsa-miR-6127	PAR-CLIP	22100165
MIRT450257	hsa-miR-6129	PAR-CLIP	22100165
MIRT450256	hsa-miR-6130	PAR-CLIP	22100165
MIRT450255	hsa-miR-6133	PAR-CLIP	22100165
MIRT450254	hsa-miR-3148	PAR-CLIP	22100165
MIRT450252	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT450253	hsa-miR-513a-5p	PAR-CLIP	22100165
MIRT450251	hsa-miR-27a-3p	PAR-CLIP	22100165
MIRT450250	hsa-miR-27b-3p	PAR-CLIP	22100165
MIRT450249	hsa-miR-6834-5p	PAR-CLIP	22100165
MIRT450248	hsa-miR-1226-5p	PAR-CLIP	22100165
MIRT450247	hsa-miR-6734-5p	PAR-CLIP	22100165
MIRT450262	hsa-miR-5584-5p	PAR-CLIP	22100165
MIRT450263	hsa-miR-3126-5p	PAR-CLIP	22100165
MIRT450261	hsa-miR-6875-5p	PAR-CLIP	22100165
MIRT450260	hsa-miR-4419a	PAR-CLIP	22100165
MIRT450259	hsa-miR-4510	PAR-CLIP	22100165
MIRT450258	hsa-miR-6127	PAR-CLIP	22100165
MIRT450257	hsa-miR-6129	PAR-CLIP	22100165
MIRT450256	hsa-miR-6130	PAR-CLIP	22100165
MIRT450255	hsa-miR-6133	PAR-CLIP	22100165
MIRT450254	hsa-miR-3148	PAR-CLIP	22100165
MIRT450252	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT450253	hsa-miR-513a-5p	PAR-CLIP	22100165
MIRT450251	hsa-miR-27a-3p	PAR-CLIP	22100165
MIRT450250	hsa-miR-27b-3p	PAR-CLIP	22100165
MIRT450249	hsa-miR-6834-5p	PAR-CLIP	22100165
MIRT450248	hsa-miR-1226-5p	PAR-CLIP	22100165
MIRT450247	hsa-miR-6734-5p	PAR-CLIP	22100165
MIRT1141715	hsa-miR-1179	CLIP-seq
MIRT1141716	hsa-miR-27a	CLIP-seq
MIRT1141717	hsa-miR-27b	CLIP-seq
MIRT1141718	hsa-miR-3163	CLIP-seq
MIRT1141719	hsa-miR-412	CLIP-seq
MIRT1141720	hsa-miR-4778-3p	CLIP-seq
MIRT1141721	hsa-miR-577	CLIP-seq
MIRT1141716	hsa-miR-27a	CLIP-seq
MIRT1141717	hsa-miR-27b	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0003712	Function	Transcription coregulator activity	IBA	21873635
GO:0003712	Function	Transcription coregulator activity	IDA	10198638
GO:0003713	Function	Transcription coactivator activity	IDA	12218053
GO:0005515	Function	Protein binding	IPI	21784977, 24981860, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	10235267
GO:0005654	Component	Nucleoplasm	TAS
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016592	Component	Mediator complex	IBA	21873635
GO:0016592	Component	Mediator complex	IDA	10198638
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0030374	Function	Nuclear receptor coactivator activity	NAS	10235266
GO:0042809	Function	Vitamin D receptor binding	NAS	10235266
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IBA	21873635
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	10198638
GO:0046966	Function	Thyroid hormone receptor binding	IDA	10198638
GO:0060261	Process	Positive regulation of transcription initiation from RNA polymerase II promoter	IDA	12218053
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
610237	23032	ENSG00000164758

Protein

UniProt ID

Q96HR3

Protein name

Mediator of RNA polymerase II transcription subunit 30 (Mediator complex subunit 30) (TRAP/Mediator complex component TRAP25) (Thyroid hormone receptor-associated protein 6) (Thyroid hormone receptor-associated protein complex 25 kDa component) (Trap25)

Protein function

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RN

PDB

7EMF , 7ENA , 7ENC , 7ENJ , 7LBM , 7NVR , 8GXQ , 8GXS , 8T9D , 8TQW , 8TRH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11315	Med30	29 → 176	Mediator complex subunit 30	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. {ECO:0000269|PubMed:11909976}.

Sequence

MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQL
PNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEE
DGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

Sequence length

178

Interactions

View interactions

	KEGG		Reactome
	Thyroid hormone signaling pathway		PPARA activates gene expression Generic Transcription Pathway Transcriptional regulation of white adipocyte differentiation

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Evidence	Source
Unknown
Schizophrenia	Schizophrenia		GWAS
Diabetes	Diabetes		GWAS
Leprosy	Leprosy		GWAS
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA
Psoriasis	Psoriasis		GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining
Ectrodactyly cardiopathy dysmorphism	Associate	40113094
Glioblastoma	Stimulate	32705436
Hypoxia	Stimulate	32705436
Neoplasms	Associate	31200735

MED30 (mediator complex subunit 30)