Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9034
Gene name Gene Name - the full gene name approved by the HGNC.	C-C motif chemokine receptor like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCRL2
Synonyms (NCBI Gene) Gene synonyms aliases	ACKR5, CKRX, CRAM, CRAM-A, CRAM-B, HCR
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune c

Show/Hide all(32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT662225	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT662224	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT662223	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT662222	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT662220	hsa-miR-4469	HITS-CLIP	23824327
MIRT662221	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT662219	hsa-miR-4287	HITS-CLIP	23824327
MIRT662218	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT662217	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT662216	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT662215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT662214	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT662213	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT662212	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT662211	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT662210	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT662225	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT662224	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT662223	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT662222	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT662220	hsa-miR-4469	HITS-CLIP	23824327
MIRT662221	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT662219	hsa-miR-4287	HITS-CLIP	23824327
MIRT662218	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT662217	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT662216	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT662215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT662214	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT662213	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT662212	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT662211	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT662210	hsa-miR-4659b-3p	HITS-CLIP	23824327

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004950	Function	Chemokine receptor activity	TAS	9473515
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	20002784
GO:0006935	Process	Chemotaxis	TAS	9473515
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006954	Process	Inflammatory response	ISS
GO:0006955	Process	Immune response	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0016493	Function	C-C chemokine receptor activity	IBA	21873635
GO:0019722	Process	Calcium-mediated signaling	IBA	21873635
GO:0019957	Function	C-C chemokine binding	IBA	21873635
GO:0042379	Function	Chemokine receptor binding	IPI	14530373
GO:0048020	Function	CCR chemokine receptor binding	IPI	20002784
GO:0060326	Process	Cell chemotaxis	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA

MIM	HGNC	e!Ensembl
608379	1612	ENSG00000121797

Protein

UniProt ID

O00421

Protein name

C-C chemokine receptor-like 2 (Chemokine receptor CCR11) (Chemokine receptor X) (Putative MCP-1 chemokine receptor)

Protein function

Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functio

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	55 → 300	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed abundantly in immunal tissues such as spleen, fetal liver, lymph node and bone marrow. Strong expression also in lung and heart. Expressed in almost all hematopoietic cells including monocytes, macrophages, PMNs, T-cells (bot

Sequence

MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVV
LILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFF
NCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYK
CAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLV
FAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY
AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

Sequence length

344

Interactions

View interactions

	Reactome
			Chemokine receptors bind chemokines

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	25340798

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Diabetes	Diabetes	GWAS
Ulcerative colitis	Ulcerative colitis	GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease	GWAS

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining
Acquired Immunodeficiency Syndrome	Associate	22046140
Arthritis Rheumatoid	Associate	15188357
Carcinoma Squamous Cell	Associate	27907906
Clinical Deterioration	Stimulate	25997515
Colorectal Neoplasms	Associate	33910576
HIV Infections	Associate	31209403
Inflammation	Associate	15188357, 22046140
Inflammation	Stimulate	25997515
Latent Tuberculosis	Associate	33328540
Leukemia Erythroblastic Acute	Associate	35179961
Leukemia Lymphocytic Chronic B Cell	Associate	21092185
Leukemia Myeloid Acute	Associate	27258612, 35179961
Lymphatic Metastasis	Associate	24695578
Myelodysplastic Syndromes	Associate	35179961
Neurocognitive Disorders	Inhibit	33373444
Neurocognitive Disorders	Associate	33373444
Oral Ulcer	Associate	35958581
Periodontitis	Associate	38167332
Plaque Atherosclerotic	Associate	35990248
Pneumonia Pneumocystis	Associate	22046140
Polycystic Ovary Syndrome	Associate	38167332
Triple Negative Breast Neoplasms	Associate	35754051
Tuberculosis	Associate	33328540
Uterine Cervical Neoplasms	Associate	24695578

CCRL2 (C-C motif chemokine receptor like 2)