NAT8 (N-acetyltransferase 8 (putative))

Gene

• Entrez ID: 9027
• Gene name: N-acetyltransferase 8 (putative)
• Gene symbol: NAT8
• Synonyms (NCBI Gene): ATase2, CCNAT, CML1, GLA, Hcml1, TSC501, TSC510
• Chromosome: 2
• Chromosome location: 2p13.1
• Summary: This gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affect

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2050440	hsa-miR-1273e	CLIP-seq
MIRT2050441	hsa-miR-2110	CLIP-seq
MIRT2050442	hsa-miR-3150a-3p	CLIP-seq
MIRT2050443	hsa-miR-4450	CLIP-seq
MIRT2050444	hsa-miR-488	CLIP-seq
MIRT2279599	hsa-miR-1245b-3p	CLIP-seq
MIRT2279600	hsa-miR-1257	CLIP-seq
MIRT2279601	hsa-miR-3199	CLIP-seq
MIRT2279602	hsa-miR-4330	CLIP-seq
MIRT2279603	hsa-miR-4790-3p	CLIP-seq
MIRT2279604	hsa-miR-576-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004468	Function	L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IEA
GO:0004468	Function	L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	TAS
GO:0005515	Function	Protein binding	IPI	19011241, 24556617, 32296183
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	20392701
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IDA	24556617
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0008080	Function	N-acetyltransferase activity	IBA
GO:0008080	Function	N-acetyltransferase activity	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	19011241, 24556617
GO:0016020	Component	Membrane	IDA	20392701
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0018003	Process	Peptidyl-lysine N6-acetylation	IDA	19011241, 24556617
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IDA	19011241
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA
GO:0047198	Function	L-cysteine-S-conjugate N-acetyltransferase activity	IDA	20392701
GO:0047198	Function	L-cysteine-S-conjugate N-acetyltransferase activity	IEA
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IDA	19011241, 24556617
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IEA
GO:1990000	Process	Amyloid fibril formation	IEA
GO:1990000	Process	Amyloid fibril formation	TAS

Other IDs

• MIM: 606716
• HGNC: 18069
• e!Ensembl: ENSG00000144035

Protein

• UniProt ID: Q9UHE5
• Protein name: N-acetyltransferase 8 (EC 2.3.1.-) (Acetyltransferase 2) (ATase2) (Camello-like protein 1) (Cysteinyl-conjugate N-acetyltransferase) (CCNAT) (EC 2.3.1.80) (Protein-lysine N6-acetyltransferase 8)
• Protein function: Endoplasmic reticulum (ER)-membrane-bound lysine N-acetyltransferase catalyzing the N6-acetylation of lysine residues in the lumen of the ER in various proteins, including PROM1 and BACE1, using acetyl-CoA as acetyl donor (PubMed:19011241, PubMe
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00583	Acetyltransf_1	74 → 193	Acetyltransferase (GNAT) family	Family

• Tissue specificity: TISSUE SPECIFICITY: Preferentially expressed in liver and kidney. Also detected in brain (at protein level). {ECO:0000269|PubMed:22267734, ECO:0000269|PubMed:9852678}.
• Sequence:

  MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSW
  LLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVG
  MVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTI
  QLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL

• Sequence length: 227

Pathways

KEGG:

Glutathione metabolism
Metabolic pathways

Reactome:

Amyloid fiber formation