Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
901
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclin G2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCNG2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The 8 species of cyclins reported in mammals, cyclins A through H, share a conserved amino acid sequence of abou
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016825 hsa-miR-335-5p Microarray 18185580
MIRT027966 hsa-miR-93-5p Sequencing 20371350
MIRT041104 hsa-miR-503-5p CLASH 23622248
MIRT737381 hsa-miR-1246 Western blotting, Immunohistochemistry (IHC), qRT-PCR 32196930
MIRT872060 hsa-let-7a CLIP-seq
Transcription factors
Transcription factor Regulation Reference
AHR Activation 22596188
FOXA1 Unknown 22596188
OTX2 Activation 21047732
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle IBA
GO:0000307 Component Cyclin-dependent protein kinase holoenzyme complex IBA
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603203 1593 ENSG00000138764
Protein
UniProt ID Q16589
Protein name Cyclin-G2
Protein function May play a role in growth regulation and in negative regulation of cell cycle progression.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 20 154 Cyclin, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: High levels in cerebellum, thymus, spleen and prostate. Low levels in skeletal muscle.
Sequence
MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKV
EDLRSLANFFGSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIP
STHDVIRISQCKCTASDIKRMEKIISEKLHYELE
ATTALNFLHLYHTIILCHTSERKEIL
SLDKLEAQLKACNCRLIFSKAKPSVLALCLLNLEVETLKSVELLEILLLVKKHSKINDTE
FFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNLHNSYYSVPELPTIPEGGCFD
ESESEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS
Sequence length 344
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  FoxO signaling pathway
p53 signaling pathway
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Sarcoidosis Sarcoidosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 22596188, 27753529
Carcinogenesis Associate 26876206
Carcinoma Hepatocellular Associate 37204480
Carcinoma Ovarian Epithelial Inhibit 26876206
Colitis Ulcerative Associate 18776587
Colorectal Neoplasms Inhibit 24307622
Crohn Disease Associate 18776587
Esophageal Neoplasms Associate 24297335
Hypoxia Associate 15790403
Kidney Neoplasms Inhibit 24272084