Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9
Gene name	N-acetyltransferase 1
Gene symbol	NAT1
Synonyms (NCBI Gene)	AAC1MNATNAT-1NATI
Chromosome	8
Chromosome location	8p22
Summary	This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and h

Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030309	hsa-miR-26b-5p	Microarray	19088304
MIRT050208	hsa-miR-25-3p	CLASH	23622248
MIRT1174316	hsa-miR-1264	CLIP-seq
MIRT1174317	hsa-miR-3613-3p	CLIP-seq
MIRT1174318	hsa-miR-548aa	CLIP-seq
MIRT1174319	hsa-miR-548ac	CLIP-seq
MIRT1174320	hsa-miR-548d-3p	CLIP-seq
MIRT1174321	hsa-miR-548z	CLIP-seq
MIRT1174322	hsa-miR-1305	CLIP-seq
MIRT1174317	hsa-miR-3613-3p	CLIP-seq
MIRT1174323	hsa-miR-3671	CLIP-seq
MIRT1174318	hsa-miR-548aa	CLIP-seq
MIRT1174319	hsa-miR-548ac	CLIP-seq
MIRT1174320	hsa-miR-548d-3p	CLIP-seq
MIRT1174321	hsa-miR-548z	CLIP-seq
MIRT1174324	hsa-miR-607	CLIP-seq
MIRT2050434	hsa-miR-582-3p	CLIP-seq
MIRT2279521	hsa-miR-1290	CLIP-seq
MIRT2279522	hsa-miR-2964a-5p	CLIP-seq
MIRT2279523	hsa-miR-3159	CLIP-seq
MIRT2279524	hsa-miR-4659a-3p	CLIP-seq
MIRT2279525	hsa-miR-4659b-3p	CLIP-seq
MIRT2279526	hsa-miR-4698	CLIP-seq
MIRT2391356	hsa-miR-151-5p	CLIP-seq
MIRT2391357	hsa-miR-151b	CLIP-seq
MIRT2391358	hsa-miR-3131	CLIP-seq
MIRT2391359	hsa-miR-611	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
AR	Activation	17210686
HSF1	Activation	20176657

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004060	Function	Arylamine N-acetyltransferase activity	IBA
GO:0004060	Function	Arylamine N-acetyltransferase activity	IEA
GO:0004060	Function	Arylamine N-acetyltransferase activity	TAS	10908296
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0016407	Function	Acetyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA

MIM	HGNC	e!Ensembl
108345	7645	ENSG00000171428

P18440

Protein name

Arylamine N-acetyltransferase 1 (EC 2.3.1.5) (Arylamide acetylase 1) (Monomorphic arylamine N-acetyltransferase) (MNAT) (N-acetyltransferase type 1) (NAT-1)

Protein function

Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.

PDB

2IJA , 2PQT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00797	Acetyltransf_2	20 → 280	N-acetyltransferase	Family

Sequence

MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVV
RRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI
VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDL
LEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT
HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI

Sequence length

290

Interactions

View interactions

	KEGG		Reactome
	Caffeine metabolism Drug metabolism - other enzymes Metabolic pathways Chemical carcinogenesis - DNA adducts		Acetylation

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
NAT1*17 ALLELE	Benign	rs4987076	RCV000019386

Show/Hide Text Mining Associations (37)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenoma	Associate	22552404
Adenomatous Polyposis Coli	Associate	14724163
Alzheimer Disease	Associate	15142281
Asthma	Associate	26641831, 31809667
Breast Neoplasms	Associate	15084249, 26965286, 29315819, 29339455, 29901116, 29969986, 31910058, 32555504, 33176066, 35906899, 37107601
Breast Neoplasms	Stimulate	29964355
Breast Neoplasms Male	Associate	22333393, 27648926
Carcinogenesis	Associate	17537267, 18069763, 26547586
Carcinoma Hepatocellular	Associate	15770721, 8396914
Cholangiocarcinoma	Associate	18069763
Colitis Ulcerative	Associate	18322880
Colonic Neoplasms	Associate	37626132
Colonic Polyps	Associate	18268115
Colorectal Neoplasms	Associate	18022202, 19549810, 35485310, 9528834
Colorectal Neoplasms	Inhibit	35485310
Conotruncal cardiac defects	Associate	21254360
Diabetes Mellitus Type 2	Associate	26409796
Drug Related Side Effects and Adverse Reactions	Associate	18069763, 25413361
Glioma	Associate	35285582
Head and Neck Neoplasms	Associate	38099560
Hereditary Breast and Ovarian Cancer Syndrome	Associate	15084249, 29339455
Inflammation	Inhibit	18069763
Leukemia Lymphocytic Chronic B Cell	Associate	20029944
Leukemia Promyelocytic Acute	Associate	15142884
Lymphoma Non Hodgkin	Associate	16847422, 17522066, 19809881, 20029944
Lymphoma T Cell	Associate	19809881
Mouth Neoplasms	Associate	23168701
Neoplasm Metastasis	Associate	29609951
Neoplasms	Associate	12832400, 15084249, 16416399, 16788383, 17210686, 17537267, 29315819, 29339455, 29969986, 31910058, 33176066, 35906899, 40054776
Neoplasms	Stimulate	29964355
Pancreatic Neoplasms	Associate	15987714, 18006927, 18499698
Precancerous Conditions	Associate	17537267, 20570911, 9577349
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	37103073
Smoke Inhalation Injury	Associate	18499698, 19809881
Stomach Neoplasms	Associate	17646057
Triple Negative Breast Neoplasms	Stimulate	29964355, 32555504
Urinary Bladder Neoplasms	Associate	10507782, 17026750, 23803105, 8110178, 8396914

NAT1 (N-acetyltransferase 1)