CDKL2 (cyclin dependent kinase like 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8999
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclin dependent kinase like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDKL2
Synonyms (NCBI Gene) Gene synonyms aliases
KKIAMRE, P56
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(78)
miRTarBase ID miRNA Experiments Reference
MIRT028804 hsa-miR-26b-5p Microarray 19088304
MIRT625368 hsa-miR-548ae-3p HITS-CLIP 23824327
MIRT625367 hsa-miR-548ah-3p HITS-CLIP 23824327
MIRT625366 hsa-miR-548aj-3p HITS-CLIP 23824327
MIRT625365 hsa-miR-548am-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0004672 Function Protein kinase activity TAS 9000130
GO:0004693 Function Cyclin-dependent protein serine/threonine kinase activity IBA 21873635
GO:0005524 Function ATP binding IEA
GO:0005634 Component Nucleus IBA 21873635
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
603442 1782 ENSG00000138769
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q92772
Protein name Cyclin-dependent kinase-like 2 (EC 2.7.11.22) (Protein kinase p56 KKIAMRE) (Serine/threonine-protein kinase KKIAMRE)
PDB 4AAA , 4BBM , 8S6I
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 4 → 287 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in testis and kidney, and at lower level in brain and lung. {ECO:0000269|PubMed:9000130}.
Sequence 
MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRH
ENLVNLLEVCKKKKRWYLVFEFVDHTILDDLELFPNGLDYQVVQKYLFQIINGIGFCHSH
NIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYG
KAVDVWAIGCLVTEMFMGEPLFPGDSDIDQLYHIMMCLGNLIPRHQELFNKNPVFAGVRL
PEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQEL
QLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPKIKDYKLFKIKGSK
IDGEKAEKGNRASNASCLHDSRTSHNKIVPSTSLKDCSNVSVDHTRNPSVAIPPLTHNLS
AVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSD
DSGADLPQMEHQH
Sequence length 493
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Testicular Germ Cell Tumor Testicular Germ Cell Tumor GWAS
Show/Hide Text Mining Associations (12)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 33178818
Carcinoma Hepatocellular Associate 33634306
Carcinoma Renal Cell Associate 33110456
Colorectal Neoplasms Associate 11180095
Drug Related Side Effects and Adverse Reactions Associate 10788436
Leprosy Lepromatous Associate 9453602
Lymphoma Follicular Associate 20208138
Myositis Inclusion Body Associate 35237874
Neoplasms Associate 18651178, 21124932
Prostatic Neoplasms Associate 26902887