Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8996
Gene name Gene Name - the full gene name approved by the HGNC.
Nucleolar protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NOL3
Synonyms (NCBI Gene) Gene synonyms aliases
ARC, FCM, MYOCL1, MYP, NOP, NOP30
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefS
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs397514600 G>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1188537 hsa-miR-1203 CLIP-seq
MIRT1188538 hsa-miR-1226 CLIP-seq
MIRT1188539 hsa-miR-1243 CLIP-seq
MIRT1188540 hsa-miR-1247 CLIP-seq
MIRT1188541 hsa-miR-1255a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001666 Process Response to hypoxia IEA
GO:0001974 Process Blood vessel remodeling IEA
GO:0002931 Process Response to ischemia IEA
GO:0003723 Function RNA binding TAS 10196175
GO:0005102 Function Signaling receptor binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605235 7869 ENSG00000140939
Protein
UniProt ID O60936
Protein name Nucleolar protein 3 (Apoptosis repressor with CARD) (Muscle-enriched cytoplasmic protein) (Myp) (Nucleolar protein of 30 kDa) (Nop30)
Protein function [Isoform 1]: May be involved in RNA splicing. ; [Isoform 2]: Functions as an apoptosis repressor that blocks multiple modes of cell death. Inhibits extrinsic apoptotic pathways through two different ways.
PDB 4UZ0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00619 CARD 9 96 Caspase recruitment domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart and skeletal muscle. Detected at low levels in placenta, liver, kidney and pancreas.
Sequence
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRR
LLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHV
GPGYRDRSYDPPCPGHWTPEAPGS
GTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAE
AEPEPELEPEPDPEPEPDFEERDESEDS
Sequence length 208
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Apoptosis  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Myoclonus myoclonus, familial, Myoclonus, familial, 1, myoclonus, familial, 1 N/A N/A GenCC, ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 22363440
Carcinoma Hepatocellular Associate 24592541
Cardiomyopathy Hypertrophic Associate 23860040
Colonic Neoplasms Associate 36273131
Colorectal Neoplasms Associate 22363440, 38166604
Glioblastoma Associate 28035070
Glioma Associate 28035070
Leukemia Myeloid Acute Associate 19490757
Migraine Disorders Associate 34380431
Neoplasms Associate 10845252