Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8989
Gene name Gene Name - the full gene name approved by the HGNC.	Transient receptor potential cation channel subfamily A member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRPA1
Synonyms (NCBI Gene) Gene synonyms aliases	ANKTM1, FEPS, FEPS1, p120
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q21.11
Summary Summary of gene provided in NCBI Entrez Gene.	The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in si

Show/Hide all(56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023904	hsa-miR-1-3p	Microarray	18668037
MIRT025846	hsa-miR-7-5p	Microarray	17612493
MIRT1457191	hsa-miR-1257	CLIP-seq
MIRT1457192	hsa-miR-1293	CLIP-seq
MIRT1457193	hsa-miR-1324	CLIP-seq
MIRT1457194	hsa-miR-1825	CLIP-seq
MIRT1457195	hsa-miR-199a-5p	CLIP-seq
MIRT1457196	hsa-miR-199b-5p	CLIP-seq
MIRT1457197	hsa-miR-30a	CLIP-seq
MIRT1457198	hsa-miR-30b	CLIP-seq
MIRT1457199	hsa-miR-30c	CLIP-seq
MIRT1457200	hsa-miR-30d	CLIP-seq
MIRT1457201	hsa-miR-30e	CLIP-seq
MIRT1457202	hsa-miR-3134	CLIP-seq
MIRT1457203	hsa-miR-3136-5p	CLIP-seq
MIRT1457204	hsa-miR-409-3p	CLIP-seq
MIRT1457205	hsa-miR-4276	CLIP-seq
MIRT1457206	hsa-miR-4302	CLIP-seq
MIRT1457207	hsa-miR-4434	CLIP-seq
MIRT1457208	hsa-miR-4439	CLIP-seq
MIRT1457209	hsa-miR-4483	CLIP-seq
MIRT1457210	hsa-miR-4513	CLIP-seq
MIRT1457211	hsa-miR-4516	CLIP-seq
MIRT1457212	hsa-miR-4531	CLIP-seq
MIRT1457213	hsa-miR-4534	CLIP-seq
MIRT1457214	hsa-miR-541	CLIP-seq
MIRT1457215	hsa-miR-643	CLIP-seq
MIRT1457216	hsa-miR-654-5p	CLIP-seq
MIRT1457217	hsa-miR-943	CLIP-seq
MIRT2137078	hsa-miR-3151	CLIP-seq
MIRT2137079	hsa-miR-3154	CLIP-seq
MIRT2137080	hsa-miR-4283	CLIP-seq
MIRT2137081	hsa-miR-4489	CLIP-seq
MIRT2137082	hsa-miR-451b	CLIP-seq
MIRT2137083	hsa-miR-664	CLIP-seq
MIRT2357849	hsa-miR-1197	CLIP-seq
MIRT2357850	hsa-miR-3150b-3p	CLIP-seq
MIRT2137078	hsa-miR-3151	CLIP-seq
MIRT2137079	hsa-miR-3154	CLIP-seq
MIRT2137080	hsa-miR-4283	CLIP-seq
MIRT2357851	hsa-miR-4420	CLIP-seq
MIRT2357852	hsa-miR-4457	CLIP-seq
MIRT2137081	hsa-miR-4489	CLIP-seq
MIRT2137082	hsa-miR-451b	CLIP-seq
MIRT2357853	hsa-miR-4639-3p	CLIP-seq
MIRT2357854	hsa-miR-4649-3p	CLIP-seq
MIRT2357855	hsa-miR-4689	CLIP-seq
MIRT2357856	hsa-miR-4731-3p	CLIP-seq
MIRT2357857	hsa-miR-4778-3p	CLIP-seq
MIRT2357858	hsa-miR-4784	CLIP-seq
MIRT2357859	hsa-miR-4789-3p	CLIP-seq
MIRT2357860	hsa-miR-4801	CLIP-seq
MIRT2357861	hsa-miR-4803	CLIP-seq
MIRT2357862	hsa-miR-493	CLIP-seq
MIRT2357863	hsa-miR-642b	CLIP-seq
MIRT2137083	hsa-miR-664	CLIP-seq

Show/Hide all(68)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003008	Process	System process	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005245	Function	Voltage-gated calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	20547126, 25855297
GO:0005886	Component	Plasma membrane	TAS	10066796
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS	10066796
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	30990108
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	ISS	25605129
GO:0009409	Process	Response to cold	IEA
GO:0009409	Process	Response to cold	IEA
GO:0009409	Process	Response to cold	IMP	20547126
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0014832	Process	Urinary bladder smooth muscle contraction	IEA
GO:0015267	Function	Channel activity	IEA
GO:0015267	Function	Channel activity	TAS	10066796
GO:0015278	Function	Intracellularly gated calcium channel activity	IBA
GO:0015278	Function	Intracellularly gated calcium channel activity	IDA	20547126
GO:0015278	Function	Intracellularly gated calcium channel activity	IMP	25855297
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019233	Process	Sensory perception of pain	IMP	20547126
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0022836	Function	Gated channel activity	IEA
GO:0030424	Component	Axon	IEA
GO:0032421	Component	Stereocilium bundle	IEA
GO:0033554	Process	Cellular response to stress	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034605	Process	Cellular response to heat	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042802	Function	Identical protein binding	IPI	25855297
GO:0048265	Process	Response to pain	IEA
GO:0050955	Process	Thermoception	IBA
GO:0050955	Process	Thermoception	IEA
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0050968	Process	Detection of chemical stimulus involved in sensory perception of pain	IBA
GO:0050968	Process	Detection of chemical stimulus involved in sensory perception of pain	IEA
GO:0050974	Process	Detection of mechanical stimulus involved in sensory perception	IEA
GO:0051289	Process	Protein homotetramerization	IDA	25855297
GO:0055085	Process	Transmembrane transport	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	30990108
GO:0070417	Process	Cellular response to cold	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IMP	20547126, 25855297
GO:0070588	Process	Calcium ion transmembrane transport	TAS
GO:0071240	Process	Cellular response to food	IEA
GO:0071240	Process	Cellular response to food	ISS	25605129
GO:0071244	Process	Cellular response to carbon dioxide	IEA
GO:0071313	Process	Cellular response to caffeine	IEA
GO:0097237	Process	Cellular response to toxic substance	IEA
GO:0097553	Process	Calcium ion transmembrane import into cytosol	IBA
GO:0097553	Process	Calcium ion transmembrane import into cytosol	IEA
GO:0097604	Function	Temperature-gated cation channel activity	IDA	20547126
GO:0098908	Process	Regulation of neuronal action potential	IEA
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1903522	Process	Regulation of blood circulation	IEA
GO:1903793	Process	Positive regulation of monoatomic anion transport	IEA
GO:1990760	Function	Osmolarity-sensing monoatomic cation channel activity	IEA

MIM	HGNC	e!Ensembl
604775	497	ENSG00000104321

Protein

UniProt ID

O75762

Protein name

Transient receptor potential cation channel subfamily A member 1 (Ankyrin-like with transmembrane domains protein 1) (Transformation-sensitive protein p120) (p120) (Wasabi receptor)

Protein function

Ligand-activated Ca(2+)-permeable, nonselective cation channel involved in pain detection and possibly also in cold perception, oxygen concentration perception, cough, itch, and inner ear function (PubMed:17259981, PubMed:21195050, PubMed:218739

PDB

3J9P , 6HC8 , 6PQO , 6PQP , 6PQQ , 6V9V , 6V9W , 6V9X , 6V9Y , 6WJ5 , 6X2J , 7JUP , 7OR0 , 7OR1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00023	Ank	97 → 129	Ankyrin repeat	Repeat
PF00023	Ank	240 → 269	Ankyrin repeat	Repeat
PF00023	Ank	341 → 373	Ankyrin repeat	Repeat
PF00023	Ank	412 → 442	Ankyrin repeat	Repeat
PF00023	Ank	481 → 511	Ankyrin repeat	Repeat
PF00023	Ank	547 → 579	Ankyrin repeat	Repeat
PF00520	Ion_trans	721 → 972	Ion transport protein	Family

Sequence

MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCD
DMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSR
GANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEA
LQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKA
TPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVD
IVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNL
LLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA
CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDL
HGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKC
TDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTII
RSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNF
KYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHM
MNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLS
SIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVY
FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSS
PLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLA
VGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIF
CFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETED
DDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP

Sequence length

1119

Interactions

View interactions

	KEGG		Reactome
	Inflammatory mediator regulation of TRP channels		TRP channels

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Episodic Pain Syndrome	familial episodic pain syndrome with predominantly upper body involvement	rs398123010	N/A

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Peripheral Neuropathy	hereditary peripheral neuropathy	N/A	N/A	GenCC

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abdominal Pain	Associate	33530940
Acute Pain	Associate	29620434
Adenocarcinoma of Lung	Associate	35733175
Anemia Sickle Cell	Associate	29620434
Arthritis	Associate	37373205
Asthma	Associate	26039217, 27758864, 27779810, 28076424, 36847817, 37386145
Atrial Fibrillation	Stimulate	28839241
Breast Neoplasms	Associate	38564162
Carcinoma Pancreatic Ductal	Associate	33479347
Cartilage Diseases	Associate	37373205
Cell Transformation Neoplastic	Associate	33479347
Cold Injury	Associate	21468319
Constipation	Associate	28478727
Cough	Associate	26039217, 35509099, 37386145
cough hypersensitivity syndrome	Associate	28931666
COVID 19	Associate	35733175
Crohn Disease	Associate	31892361
Diabetic Neuropathies	Associate	36430572
Drug Hypersensitivity	Associate	28436534, 33530940
Drug Related Side Effects and Adverse Reactions	Associate	37511605
Dyspareunia	Associate	28478727
Edema	Associate	26039217
Endometriosis	Stimulate	25029427
Endometriosis	Associate	28478727
Fibrosis	Associate	33579280
Glioblastoma	Associate	35982414
Glycosuria Renal	Associate	34488389
Hyperalgesia	Associate	21468319, 26358221
Idiopathic Pulmonary Fibrosis	Stimulate	29149168
Inflammation	Associate	23220116, 26039217, 26358221, 27779810, 32986378, 33479347, 34198528, 34302984, 37373205
Inflammation	Stimulate	28076424, 37386145
Irritable Bowel Syndrome	Associate	33530940
Lung Neoplasms	Associate	37511605
Nasopharyngeal Carcinoma	Associate	32986378
Nasopharyngitis	Associate	32986378
Necrosis	Stimulate	34440820
Neoplasms	Associate	33076385, 33479347, 36012311, 37834182, 38564162
Nervous System Diseases	Associate	36098890
Neuralgia	Associate	21468319, 32080151, 37079850, 37079968
Neurodermatitis	Inhibit	33183050
Neurogenic Inflammation	Associate	31892361, 37386145
Neuromuscular Diseases	Associate	28436534
Osteoarthritis Knee	Associate	39313491
Pain	Associate	20547126, 23220116, 24496475, 24975826, 26358221, 28076424, 29596157, 29620434, 31892361, 33076385, 33479347, 33530940, 34302984, 35806193, 37373205 View all (4 more)
Paine syndrome	Associate	20547126
Pancreatic Neoplasms	Associate	33479347, 36012311
Peripheral Nervous System Diseases	Associate	35806193, 38564162
Plasma Cell Granuloma Pulmonary	Associate	34302984
Prostatic Neoplasms	Associate	28277613
Pruritus	Associate	33183050, 37386145
Pulmonary Disease Chronic Obstructive	Associate	28076424
Sarcoma Synovial	Associate	33076385
Signs and Symptoms	Associate	28436534
Small Fiber Neuropathy	Associate	36430572, 37079968
Squamous Cell Carcinoma of Head and Neck	Stimulate	35163843

TRPA1 (transient receptor potential cation channel subfamily A member 1)