Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	89885
Gene name Gene Name - the full gene name approved by the HGNC.	Fetal and adult testis expressed 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FATE1
Synonyms (NCBI Gene) Gene synonyms aliases	CT43, FATE
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xq28
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli c

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2227289	hsa-miR-1910	CLIP-seq
MIRT2227290	hsa-miR-4691-5p	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 22458338, 25416956, 25910212, 26871637, 29892012, 31515488, 32296183
GO:0005741	Component	Mitochondrial outer membrane	IBA	21873635
GO:0005741	Component	Mitochondrial outer membrane	IDA	12865919
GO:0005783	Component	Endoplasmic reticulum	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA	21873635
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	26567849
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043066	Process	Negative regulation of apoptotic process	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	IDA	12865919, 26567849
GO:0044233	Component	Mitochondria-associated endoplasmic reticulum membrane	IBA	21873635
GO:0044233	Component	Mitochondria-associated endoplasmic reticulum membrane	IDA	12865919
GO:0051562	Process	Negative regulation of mitochondrial calcium ion concentration	IBA	21873635
GO:0051562	Process	Negative regulation of mitochondrial calcium ion concentration	IDA	12865919

MIM	HGNC	e!Ensembl
300450	24683	ENSG00000147378

Protein

UniProt ID

Q969F0

Protein name

Fetal and adult testis-expressed transcript protein (Cancer/testis antigen 43) (CT43) (Tumor antigen BJ-HCC-2)

Protein function

Involved in the regulation of endoplasmic reticulum (ER)-mitochondria coupling. Negatively regulates the ER-mitochondria distance and Ca(2+) transfer from ER to mitochondria possibly implicating it in the regulation of apoptosis (PubMed:27402544

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05644	Miff	13 → 183	Mitochondrial and peroxisomal fission factor Mff	Family

Tissue specificity

TISSUE SPECIFICITY: Testis-specific in fetus (aged from 6 to 11 weeks). In adult, expressed predominantly in testis, with some expression in lung, heart, kidney, adrenal gland and whole brain (PubMed:11694338). Highly expressed in certain types of cancer

Sequence

MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAG
SASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDA
VAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLW
MNQ

Sequence length

183

Interactions

View interactions

FATE1 (fetal and adult testis expressed 1)