CCNE1 (cyclin E1)

Gene

• Entrez ID: 898
• Gene name: Cyclin E1
• Gene symbol: CCNE1
• Synonyms (NCBI Gene): CCNE, pCCNE1
• Chromosome: 19
• Chromosome location: 19q12
• Summary: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001228	hsa-miR-15a-5p	qRT-PCR, Luciferase reporter assay, Western blot	19591824
MIRT001228	hsa-miR-15a-5p	qRT-PCR, Luciferase reporter assay, Western blot	19591824
MIRT001226	hsa-miR-16-5p	qRT-PCR, Luciferase reporter assay, Western blot	19591824
MIRT001226	hsa-miR-16-5p	qRT-PCR, Luciferase reporter assay, Western blot	19591824
MIRT001226	hsa-miR-16-5p	qRT-PCR, flow, Luciferase reporter assay, Western blot	18701644
MIRT001226	hsa-miR-16-5p	qRT-PCR, flow, Western blot	18701644
MIRT000936	hsa-miR-424-5p	qRT-PCR, flow, Western blot	18701644
MIRT000936	hsa-miR-424-5p	Luciferase reporter assay	19956200
MIRT000646	hsa-miR-503-5p	Luciferase reporter assay	19956200
MIRT001228	hsa-miR-15a-5p	Luciferase reporter assay	19549910
MIRT001228	hsa-miR-15a-5p	Luciferase reporter assay	19549910
MIRT000276	hsa-miR-15b-5p	Luciferase reporter assay	18794849
MIRT001226	hsa-miR-16-5p	Luciferase reporter assay	18701644
MIRT001226	hsa-miR-16-5p	Review	20130964
MIRT001228	hsa-miR-15a-5p	immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR	19117988
MIRT004693	hsa-miR-107	Flow, Immunoblot, Microarray, qRT-PCR	19688090
MIRT004698	hsa-miR-185-5p	Flow, Immunoblot, Microarray, qRT-PCR	19688090
MIRT004762	hsa-miR-103a-3p	Luciferase reporter assay, qRT-PCR, Western blot	20886090
MIRT000276	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	19135980
MIRT000276	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	19135980
MIRT001226	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	19250063
MIRT001226	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	19250063
MIRT000936	hsa-miR-424-5p	Immunohistochemistry, qRT-PCR, Western blot	21179471
MIRT006308	hsa-miR-26b-5p	Luciferase reporter assay, Western blot	22210897
MIRT006309	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	22210897
MIRT006308	hsa-miR-26b-5p	Luciferase reporter assay, Western blot	22210897
MIRT006309	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	22210897
MIRT006308	hsa-miR-26b-5p	Luciferase reporter assay, Western blot	22210897
MIRT006309	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	22210897
MIRT006741	hsa-miR-16-1-3p	Luciferase reporter assay	19944013
MIRT006741	hsa-miR-16-1-3p	Luciferase reporter assay	19944013
MIRT006741	hsa-miR-16-1-3p	Luciferase reporter assay	19944013
MIRT006741	hsa-miR-16-1-3p	Luciferase reporter assay	19944013
MIRT001226	hsa-miR-16-5p	Luciferase reporter assay	23083510
MIRT007237	hsa-miR-195-5p	Luciferase reporter assay	23383003
MIRT024440	hsa-miR-215-5p	Microarray	19074876
MIRT026235	hsa-miR-192-5p	Microarray	19074876
MIRT001226	hsa-miR-16-5p	Microarray	21199864
MIRT035523	hsa-miR-151a-3p	Luciferase reporter assay	23416081
MIRT001226	hsa-miR-16-5p	CLASH	23622248
MIRT049367	hsa-miR-92a-3p	CLASH	23622248
MIRT049367	hsa-miR-92a-3p	CLASH	23622248
MIRT045919	hsa-miR-125b-5p	CLASH	23622248
MIRT038211	hsa-miR-342-5p	CLASH	23622248
MIRT000276	hsa-miR-15b-5p	qRT-PCR, Western blot	22045185
MIRT001228	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23900351
MIRT081649	hsa-miR-497-5p	Luciferase reporter assay, Western blot	24112607
MIRT081649	hsa-miR-497-5p	Luciferase reporter assay, Western blot	24112607
MIRT007237	hsa-miR-195-5p	Luciferase reporter assay, Western blot	23544130
MIRT081649	hsa-miR-497-5p	Luciferase reporter assay, Western blot	23544130
MIRT438133	hsa-miR-7-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24370822
MIRT438133	hsa-miR-7-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24370822
MIRT438133	hsa-miR-7-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24370822
MIRT438133	hsa-miR-7-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24370822
MIRT081649	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT007237	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT001226	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT000936	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000276	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT001228	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT081654	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT000646	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT081652	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT558888	hsa-miR-646	PAR-CLIP	20371350
MIRT081648	hsa-miR-383-3p	PAR-CLIP	20371350
MIRT558887	hsa-miR-5191	PAR-CLIP	20371350
MIRT081651	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT081653	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT558884	hsa-miR-4477a	PAR-CLIP	20371350
MIRT001228	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT000936	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT081649	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT001226	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT081654	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT000276	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT007237	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT000646	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT081652	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT558888	hsa-miR-646	PAR-CLIP	21572407
MIRT081648	hsa-miR-383-3p	PAR-CLIP	21572407
MIRT558887	hsa-miR-5191	PAR-CLIP	21572407
MIRT558886	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT558885	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT081651	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT081653	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT558884	hsa-miR-4477a	PAR-CLIP	21572407
MIRT001228	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT000276	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT001226	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT007237	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT006309	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT006308	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT438133	hsa-miR-7-5p	qRT-PCR, Western blot	27391479
MIRT001228	hsa-miR-15a-5p	Western blot	26397135
MIRT001226	hsa-miR-16-5p	Western blot	26397135
MIRT001226	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	25830480
MIRT001226	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	25830480
MIRT007237	hsa-miR-195-5p	qRT-PCR	31656079
MIRT734771	hsa-miR-29b-3p	Luciferase reporter assay, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR	33679655
MIRT081649	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT007237	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT001226	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT000936	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT000276	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT001228	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT081654	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT000646	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT081652	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT558888	hsa-miR-646	PAR-CLIP	20371350
MIRT081648	hsa-miR-383-3p	PAR-CLIP	20371350
MIRT558887	hsa-miR-5191	PAR-CLIP	20371350
MIRT081651	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT081653	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT558884	hsa-miR-4477a	PAR-CLIP	20371350
MIRT001228	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT000936	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT081649	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT001226	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT081654	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT000276	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT007237	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT000646	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT081652	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT558888	hsa-miR-646	PAR-CLIP	21572407
MIRT081648	hsa-miR-383-3p	PAR-CLIP	21572407
MIRT558887	hsa-miR-5191	PAR-CLIP	21572407
MIRT558886	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT558885	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT081651	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT081653	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT558884	hsa-miR-4477a	PAR-CLIP	21572407
MIRT871795	hsa-miR-103a	CLIP-seq
MIRT871796	hsa-miR-1289	CLIP-seq
MIRT871797	hsa-miR-1297	CLIP-seq
MIRT871798	hsa-miR-15a	CLIP-seq
MIRT871799	hsa-miR-15b	CLIP-seq
MIRT871800	hsa-miR-16	CLIP-seq
MIRT871801	hsa-miR-185	CLIP-seq
MIRT871802	hsa-miR-195	CLIP-seq
MIRT871803	hsa-miR-2114	CLIP-seq
MIRT871804	hsa-miR-26a	CLIP-seq
MIRT871805	hsa-miR-26b	CLIP-seq
MIRT871806	hsa-miR-29a	CLIP-seq
MIRT871807	hsa-miR-29b	CLIP-seq
MIRT871808	hsa-miR-29c	CLIP-seq
MIRT871809	hsa-miR-424	CLIP-seq
MIRT871810	hsa-miR-4306	CLIP-seq
MIRT871811	hsa-miR-4465	CLIP-seq
MIRT871812	hsa-miR-4491	CLIP-seq
MIRT871813	hsa-miR-4524	CLIP-seq
MIRT871814	hsa-miR-4644	CLIP-seq
MIRT871815	hsa-miR-4657	CLIP-seq
MIRT871816	hsa-miR-497	CLIP-seq
MIRT871817	hsa-miR-503	CLIP-seq
MIRT871818	hsa-miR-505	CLIP-seq
MIRT871819	hsa-miR-562	CLIP-seq
MIRT871820	hsa-miR-587	CLIP-seq
MIRT871795	hsa-miR-103a	CLIP-seq
MIRT871821	hsa-miR-1204	CLIP-seq
MIRT871822	hsa-miR-1231	CLIP-seq
MIRT871796	hsa-miR-1289	CLIP-seq
MIRT871823	hsa-miR-1291	CLIP-seq
MIRT871797	hsa-miR-1297	CLIP-seq
MIRT871824	hsa-miR-138	CLIP-seq
MIRT871825	hsa-miR-144	CLIP-seq
MIRT871826	hsa-miR-146b-3p	CLIP-seq
MIRT871798	hsa-miR-15a	CLIP-seq
MIRT871799	hsa-miR-15b	CLIP-seq
MIRT871800	hsa-miR-16	CLIP-seq
MIRT871802	hsa-miR-195	CLIP-seq
MIRT871803	hsa-miR-2114	CLIP-seq
MIRT871804	hsa-miR-26a	CLIP-seq
MIRT871805	hsa-miR-26b	CLIP-seq
MIRT871806	hsa-miR-29a	CLIP-seq
MIRT871807	hsa-miR-29b	CLIP-seq
MIRT871808	hsa-miR-29c	CLIP-seq
MIRT871827	hsa-miR-3140-3p	CLIP-seq
MIRT871828	hsa-miR-3157-3p	CLIP-seq
MIRT871829	hsa-miR-3173-5p	CLIP-seq
MIRT871830	hsa-miR-328	CLIP-seq
MIRT871831	hsa-miR-3652	CLIP-seq
MIRT871832	hsa-miR-3682-5p	CLIP-seq
MIRT871833	hsa-miR-3689d	CLIP-seq
MIRT871809	hsa-miR-424	CLIP-seq
MIRT871834	hsa-miR-4265	CLIP-seq
MIRT871835	hsa-miR-4290	CLIP-seq
MIRT871836	hsa-miR-4296	CLIP-seq
MIRT871837	hsa-miR-4322	CLIP-seq
MIRT871838	hsa-miR-4430	CLIP-seq
MIRT871811	hsa-miR-4465	CLIP-seq
MIRT871839	hsa-miR-4505	CLIP-seq
MIRT871813	hsa-miR-4524	CLIP-seq
MIRT871840	hsa-miR-4648	CLIP-seq
MIRT871841	hsa-miR-4654	CLIP-seq
MIRT871842	hsa-miR-4769-5p	CLIP-seq
MIRT871816	hsa-miR-497	CLIP-seq
MIRT871843	hsa-miR-498	CLIP-seq
MIRT871817	hsa-miR-503	CLIP-seq
MIRT871844	hsa-miR-516b	CLIP-seq
MIRT871845	hsa-miR-521	CLIP-seq
MIRT871819	hsa-miR-562	CLIP-seq
MIRT871820	hsa-miR-587	CLIP-seq
MIRT871846	hsa-miR-663b	CLIP-seq
MIRT871847	hsa-miR-874	CLIP-seq
MIRT871843	hsa-miR-498	CLIP-seq
MIRT871795	hsa-miR-103a	CLIP-seq
MIRT871822	hsa-miR-1231	CLIP-seq
MIRT2195464	hsa-miR-1256	CLIP-seq
MIRT871797	hsa-miR-1297	CLIP-seq
MIRT871824	hsa-miR-138	CLIP-seq
MIRT871798	hsa-miR-15a	CLIP-seq
MIRT871799	hsa-miR-15b	CLIP-seq
MIRT871800	hsa-miR-16	CLIP-seq
MIRT871802	hsa-miR-195	CLIP-seq
MIRT871803	hsa-miR-2114	CLIP-seq
MIRT871804	hsa-miR-26a	CLIP-seq
MIRT871805	hsa-miR-26b	CLIP-seq
MIRT871806	hsa-miR-29a	CLIP-seq
MIRT871807	hsa-miR-29b	CLIP-seq
MIRT871808	hsa-miR-29c	CLIP-seq
MIRT871831	hsa-miR-3652	CLIP-seq
MIRT871833	hsa-miR-3689d	CLIP-seq
MIRT2195465	hsa-miR-3910	CLIP-seq
MIRT871809	hsa-miR-424	CLIP-seq
MIRT871838	hsa-miR-4430	CLIP-seq
MIRT871811	hsa-miR-4465	CLIP-seq
MIRT871839	hsa-miR-4505	CLIP-seq
MIRT871813	hsa-miR-4524	CLIP-seq
MIRT871816	hsa-miR-497	CLIP-seq
MIRT871817	hsa-miR-503	CLIP-seq
MIRT871818	hsa-miR-505	CLIP-seq
MIRT871844	hsa-miR-516b	CLIP-seq
MIRT871845	hsa-miR-521	CLIP-seq
MIRT2195466	hsa-miR-548an	CLIP-seq
MIRT871819	hsa-miR-562	CLIP-seq
MIRT871820	hsa-miR-587	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARNT	Repression	21544813
CBX7	Repression	22214847
E2F1	Activation	14618416;20220142;8618861
EP300	Activation	12414652
EZH2	Activation	20132185
HDAC2	Repression	22214847
IRF1	Repression	22200613
MYC	Activation	20607601
NR5A2	Unknown	19041685
PPARG	Repression	14960510
PROX1	Activation	21040746
TCF19	Repression	15051733
TFDP1	Activation	12029633;14618416
WT1	Repression	11919196
ZHX2	Repression	22406477

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	21873635
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA	21873635
GO:0000082	Process	G1/S transition of mitotic cell cycle	IMP	23083510, 25732226
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	8207080
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS
GO:0000083	Process	Regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA	21873635
GO:0000723	Process	Telomere maintenance	IEA
GO:0005515	Function	Protein binding	IPI	8756624, 9840943, 9891079, 10330164, 16431923, 16504183, 16721056, 16765349, 17254966, 17254967, 17434132, 17525332, 19470470, 21092281, 21540187, 21952639, 21988832, 23455922, 23602568, 23853094, 24358021, 25241761, 25852190, 28514442, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	16109376, 19942931
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006270	Process	DNA replication initiation	IEA
GO:0006468	Process	Protein phosphorylation	IMP	10500095
GO:0007129	Process	Homologous chromosome pairing at meiosis	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA	21873635
GO:0019901	Function	Protein kinase binding	IEA
GO:0044772	Process	Mitotic cell cycle phase transition	IBA	21873635
GO:0051301	Process	Cell division	IEA
GO:0097134	Component	Cyclin E1-CDK2 complex	IBA	21873635
GO:0097134	Component	Cyclin E1-CDK2 complex	IDA	18305109
GO:1902462	Process	Positive regulation of mesenchymal stem cell proliferation	IMP	23083510
GO:1903827	Process	Regulation of cellular protein localization	IEA

Other IDs

• MIM: 123837
• HGNC: 1589
• e!Ensembl: ENSG00000105173

Protein

• UniProt ID: P24864
• Protein name: G1/S-specific cyclin-E1
• Protein function: Essential for the control of the cell cycle at the G1/S (start) transition.
• PDB: 1W98, 5L2W, 7KJS, 7XQK, 8H4R, 8H6P, 8H6T, 8VQ3, 8VQ4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00134	Cyclin_N	115 → 242	Cyclin, N-terminal domain	Domain
  PF02984	Cyclin_C	244 → 366	Cyclin, C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in testis and placenta. Low levels in bronchial epithelial cells. {ECO:0000269|PubMed:9840943}.
• Sequence:

  MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
  PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM
  LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
  ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
  LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
  ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
  QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA

• Sequence length: 410

Pathways

KEGG:

Cell cycle
Oocyte meiosis
p53 signaling pathway
PI3K-Akt signaling pathway
Cellular senescence
Cushing syndrome
Hepatitis B
Measles
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Prostate cancer
Small cell lung cancer
Gastric cancer

Reactome:

G0 and Early G1
SCF(Skp2)-mediated degradation of p27/p21
DNA Damage/Telomere Stress Induced Senescence
TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest
CDK-mediated phosphorylation and removal of Cdc6
Phosphorylation of proteins involved in G1/S transition by active Cyclin E:Cdk2 complexes
Cyclin E associated events during G1/S transition
G1/S-Specific Transcription
p53-Dependent G1 DNA Damage Response
PTK6 Regulates Cell Cycle

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243	23624423, 19385967
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	23624423, 19385967
Carcinoma of the head and neck	Squamous cell carcinoma of the head and neck	rs121909237, rs121909250, rs121909251, rs121909252, rs28934571, rs28934574, rs28934576, rs28934578, rs121912664, rs397516436, rs121912666, rs397514495, rs587782705, rs193920774, rs730882001, rs786201838, rs587782144, rs866775781, rs730882008, rs1567549584, rs1597371666, rs1597365075	29464035
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465, rs137854466, rs137854467, rs387906547, rs387906548, rs137854469, rs137854473, rs1131692050, rs112989722, rs137854474, rs137854476, rs140593, rs1555395819, rs137854478, rs137854479, rs137854480, rs137854481, rs137854482, rs137854483, rs137854484, rs137854485, rs112289537, rs193922181, rs193922182, rs193922185, rs140603, rs193922187, rs193922188, rs193921256, rs112660651, rs193922193, rs193922194, rs193922197, rs193922198, rs193922199, rs193922203, rs193922204, rs193922205, rs193922206, rs111401431, rs193922207, rs113871094, rs111671429, rs193922216, rs193922219, rs193922220, rs193922223, rs193922224, rs193922225, rs193922226, rs193922227, rs193922228, rs193922230, rs193922235, rs147195031, rs193922236, rs193922239, rs193922240, rs193922241, rs193922246, rs397514558, rs398122934, rs397515753, rs397515754, rs397515755, rs397515756, rs397515757, rs113812345, rs397515758, rs397515759, rs397515762, rs25403, rs397515765, rs397515766, rs397515767, rs397515768, rs397515769, rs397515770, rs397515771, rs25404, rs397515773, rs397515774, rs397515775, rs397515776, rs397515778, rs397515779, rs397515781, rs112202622, rs397515782, rs397515784, rs397515785, rs397515786, rs397515788, rs397515789, rs397515790, rs397515791, rs397515792, rs397515793, rs397515794, rs397515797, rs397515798, rs397515799, rs397515801, rs397515802, rs397515803, rs397515804, rs397515805, rs397515808, rs397515810, rs397515811, rs397515812, rs111231312, rs267606798, rs397515814, rs113905529, rs397515816, rs397515817, rs397515818, rs397515819, rs397515820, rs363853, rs113249837, rs397515821, rs111929350, rs397515823, rs397515824, rs113086760, rs397515825, rs397515826, rs397515827, rs363807, rs397515828, rs397515829, rs397515830, rs397515831, rs397515833, rs111687884, rs113080385, rs397515834, rs397515836, rs113001196, rs397515840, rs397515845, rs397515846, rs397515847, rs397515848, rs397515851, rs397515852, rs397515853, rs397515854, rs111856492, rs397515859, rs397515861, rs397515863, rs397515864, rs397515865, rs397515866, rs397515867, rs137854855, rs199474693, rs587782944, rs587782947, rs587782948, rs672601352, rs876658120, rs727504651, rs727503054, rs727504315, rs727504411, rs727503057, rs727504454, rs200309328, rs363811, rs727504410, rs363821, rs727504347, rs727505006, rs727505110, rs730880356, rs727505269, rs727503058, rs727504421, rs730880107, rs730880104, rs730880103, rs730880102, rs730880101, rs730880106, rs730880100, rs730880105, rs730880099, rs112645512, rs730880108, rs730880098, rs730880097, rs794728321, rs794728283, rs794728280, rs794728336, rs794728272, rs794728160, rs794728271, rs794728270, rs794728319, rs794728262, rs794728251, rs76702162, rs794728335, rs794728334, rs794728246, rs763091520, rs794728333, rs794728237, rs761857514, rs794728234, rs140630, rs794728231, rs794728228, rs794728225, rs794728308, rs794728216, rs794728221, rs763449629, rs201058219, rs794728210, rs794728208, rs794728206, rs794728199, rs794728195, rs794728194, rs794728193, rs794728190, rs1555399381, rs794728176, rs1555399968, rs113422242, rs794728326, rs794728166, rs794728325, rs794728165, rs794728162, rs794728213, rs869025417, rs112642323, rs869025416, rs869025415, rs869025424, rs869025423, rs869025414, rs869025422, rs869025413, rs869025412, rs869025411, rs869025418, rs869025426, rs869025406, rs869025421, rs869025425, rs869025404, rs869025420, rs869025403, rs398122833, rs876657645, rs878853686, rs878853676, rs886038919, rs886038795, rs187553035, rs886038869, rs886038949, rs886038967, rs886038976, rs886038848, rs886038940, rs886038877, rs886039038, rs886038817, rs886038963, rs886039036, rs886038797, rs886039550, rs886041482, rs1057517855, rs1057518912, rs1057518973, rs1057519502, rs1057521100, rs1057521102, rs1057518881, rs1057520617, rs1057521101, rs1555394445, rs369058466, rs1060501069, rs1060501031, rs778966916, rs1060501043, rs1555397663, rs1060501017, rs1060501094, rs1060501065, rs1555393848, rs1555394151, rs1060501051, rs1060501013, rs1060501054, rs1060501048, rs1060501089, rs1060501039, rs1555398160, rs1060501022, rs1060501024, rs1060501086, rs1060501058, rs1060501036, rs1060501100, rs1060501042, rs1060501059, rs1555397743, rs1060501021, rs1060501027, rs1060501096, rs1060501038, rs1060501050, rs1064794130, rs112118237, rs1064793980, rs1064793118, rs1064793636, rs1064794282, rs1064793559, rs1085307921, rs1085308004, rs1085307468, rs112907302, rs1131691479, rs1131691373, rs1131691467, rs1131691938, rs1131691311, rs1131691806, rs1131691317, rs1555393827, rs363804, rs1555397738, rs1555399144, rs1555400274, rs1555394195, rs1555398836, rs113543334, rs1555399825, rs1555394626, rs1555395256, rs1555395257, rs1555396427, rs1555397548, rs1555398173, rs1555404803, rs1232880706, rs1555393825, rs1555394567, rs1555396998, rs1555394928, rs1555397203, rs112375043, rs1555397720, rs140599, rs1555399150, rs1555400373, rs1555405041, rs1555395229, rs1555397671, rs775417975, rs1555398774, rs1555399368, rs1555394904, rs1555395987, rs1555397424, rs1555398377, rs1555398835, rs1555401011, rs1555405043, rs1555394580, rs1555397404, rs1555398511, rs1555395826, rs1555399372, rs1555399821, rs1555399836, rs1555400063, rs363810, rs1555397655, rs1555395756, rs1555395742, rs1555393844, rs112550005, rs1555395002, rs1555395658, rs765387131, rs1555396429, rs1555396835, rs1555397014, rs1555397016, rs778710767, rs1555397557, rs1555397704, rs140648, rs1555398406, rs1555398681, rs1555399257, rs1555399361, rs1555399764, rs1555405056, rs1555393510, rs1555395980, rs1555396789, rs1555399094, rs1555399378, rs1555399816, rs1555395645, rs371097218, rs1555398278, rs1555394238, rs1555396418, rs1206813753, rs1555399271, rs1555405044, rs113544411, rs1555395663, rs1555397216, rs1555398989, rs1555399149, rs1555401670, rs1555395001, rs1445085747, rs1555393538, rs1555393565, rs1404133653, rs1555394450, rs1555394581, rs1555394633, rs1555394900, rs1555395189, rs1555395261, rs1052480459, rs1555395480, rs1555395670, rs363806, rs1555395820, rs1555396419, rs1555396765, rs1296209846, rs794728233, rs1555396853, rs1555396863, rs1555397197, rs1555397204, rs1555397212, rs1555397713, rs1555397736, rs1555398139, rs1555398144, rs1555398409, rs1555398510, rs1555398520, rs1555398524, rs1555398667, rs1555399089, rs1555399482, rs1555399763, rs1555401002, rs794728323, rs1555393508, rs1555393514, rs1555393525, rs1555393532, rs1555393653, rs1555393657, rs1555393824, rs1555393831, rs112196241, rs1555393847, rs1555393862, rs1555393863, rs1555393866, rs113935744, rs1555393882, rs1555393886, rs1555393889, rs1555394138, rs1555394144, rs1555394146, rs1555394148, rs1555394149, rs1555394152, rs1555394153, rs1555394189, rs1555394197, rs1555394206, rs1555394212, rs1555394218, rs1555394220, rs1555394235, rs1555394245, rs1555394246, rs1057520728, rs1555394390, rs1555394391, rs537570299, rs1555394397, rs1555394398, rs1555394399, rs1555394402, rs1555394407, rs1555394412, rs1555394435, rs1555394436, rs1555394441, rs1555394556, rs1555394557, rs1555394559, rs1555394561, rs1555394570, rs397515844, rs1555394571, rs1555394574, rs1555394579, rs1555394582, rs534811966, rs111588631, rs1555394628, rs1555394629, rs1555394630, rs1555394631, rs1555394641, rs1555394644, rs1555394647, rs1555394756, rs886051245, rs1555394775, rs1555394776, rs1555394777, rs1555394779, rs1555394780, rs1555394783, rs1555394901, rs1555394906, rs1555394925, rs794728253, rs886039158, rs1555395013, rs1555395187, rs1555395188, rs1555395203, rs1555395205, rs363815, rs1246984265, rs794728245, rs1555395263, rs1555395267, rs1555395456, rs1555395475, rs1555395482, rs1555395638, rs1555395641, rs1555395648, rs1555395653, rs1555395659, rs111239111, rs1555395745, rs1555395747, rs1555395753, rs1555395757, rs1555395766, rs1555395767, rs1555395843, rs1555395846, rs1555395849, rs1555395978, rs1555395981, rs1555395984, rs1555395989, rs1555395990, rs1260109901, rs1555396186, rs1555396188, rs1555396198, rs1555396199, rs1555396201, rs1555396202, rs1555396205, rs1555396213, rs1555396424, rs1555396426, rs1555396428, rs1555396435, rs1555396630, rs1555396635, rs1555396636, rs1555396639, rs1555396757, rs1555396769, rs1555396838, rs1555396844, rs140627, rs1555396858, rs1555396990, rs1555396991, rs1555396993, rs769588424, rs1555397022, rs1555397024, rs1555397160, rs1555397174, rs1555397176, rs1555397193, rs1555397209, rs1555397210, rs1555397214, rs1060501076, rs113082854, rs113693945, rs111978932, rs1555397403, rs1555397419, rs1555397420, rs1555397421, rs1555397536, rs1555397537, rs1555397540, rs1555397542, rs1555397543, rs1555397545, rs1555397546, rs1555397670, rs1555397692, rs1555397718, rs1555397723, rs1555397744, rs113393517, rs1555398148, rs1555398152, rs1555398174, rs1555398176, rs1555398179, rs1555398282, rs1555398287, rs1555398380, rs1555398394, rs1555398397, rs1555398401, rs1555398404, rs1555398407, rs1555398413, rs1555398501, rs1555398508, rs1555398512, rs1555398513, rs1555398515, rs1555398521, rs794728205, rs1555398527, rs1555398551, rs1060501075, rs1555398566, rs1555398572, rs1555398580, rs1555398582, rs140597, rs1555398622, rs1555398624, rs1555398625, rs112547596, rs1555398627, rs1555398633, rs1555398637, rs1555398642, rs778867355, rs1555398648, rs1555398659, rs1293095681, rs1060501040, rs987202268, rs1555398672, rs1555398673, rs1555398677, rs1555398793, rs1555398803, rs1555398811, rs1555398826, rs1555398833, rs1555398974, rs1555398981, rs778900586, rs1555398988, rs1555398994, rs1555398995, rs1555398996, rs1555399093, rs869025405, rs1555399101, rs1555399146, rs1555399160, rs1555399162, rs1555399164, rs1555399165, rs1555399193, rs1555399195, rs1555399202, rs1555399204, rs1555399206, rs201778577, rs1555399210, rs1555399214, rs1555399270, rs1555399273, rs1555399281, rs1555399371, rs1555399385, rs1555399477, rs1555399484, rs1555399761, rs1555399775, rs1555399802, rs1555399804, rs1555399837, rs1555399840, rs1555399940, rs1555399944, rs1555399949, rs1555399953, rs1555399954, rs1555399955, rs1555399959, rs1555399962, rs1555399963, rs1060501041, rs1555399974, rs1555399976, rs1555399977, rs1555400049, rs794728172, rs1555400062, rs1555400064, rs1555400066, rs1555400267, rs1555400268, rs1555400278, rs794728168, rs1555400279, rs1156747241, rs1555400288, rs1555400371, rs1555400372, rs1555400379, rs1555400385, rs587782943, rs1555400387, rs1555400406, rs1439533354, rs746201757, rs1555400595, rs1555400603, rs1555400604, rs1555400606, rs1555400609, rs752010116, rs1555400612, rs1555400616, rs1555401004, rs1555401005, rs146348130, rs1555401667, rs1555401671, rs1555401676, rs1555401679, rs1555401687, rs1555401689, rs1555401695, rs1555401697, rs1555401701, rs1555404799, rs1555404800, rs200295020, rs1555404810, rs1555404820, rs1555405031, rs1555405039, rs1555405045, rs1555405530, rs794728292, rs1555405533, rs1555405536, rs1555405537, rs111764111, rs1555405658, rs1555405664, rs774371494, rs1555405673, rs1555407399, rs1555407414, rs1555407423, rs1555407429, rs886041536, rs1555404806, rs1566911709, rs1566913974, rs1566894226, rs1566895223, rs1566897376, rs1566902526, rs1566915277, rs1566897374, rs1566897420, rs1566891655, rs1346043320, rs1566922396, rs1566891706, rs1566894783, rs1566913670, rs1555394196, rs1566891454, rs1566891406, rs1566891404, rs1566895262, rs1566891645, rs1566895225, rs1566896114, rs1566898399, rs1566904011, rs1566906537, rs1566908956, rs1566909766, rs1566919599, rs1566937712, rs1566915335, rs1566891675, rs1566904526, rs1566906506, rs1566900540, rs1566894230, rs1555395206, rs1566891797, rs1597512576, rs1597523873, rs1597581001, rs1597516325, rs1057524757, rs1597506641, rs1597520781, rs1597593695, rs1597529829, rs1597520625, rs1597579923, rs1597531796, rs1008275504, rs1597567249, rs1597569265, rs1597652471, rs1597516347, rs1597577114, rs1597633163, rs1597519658, rs1597593852, rs1597516501, rs1566913982, rs1555393859, rs1597513708, rs368978109, rs1480832655, rs1597520683, rs1597522390, rs1597522553, rs1597529748, rs1597533707, rs1597537815, rs1597545309, rs1597545836, rs1597563234, rs1597563280, rs1597564359, rs772108557, rs1597568968, rs1597574236, rs1597574308, rs1597577975, rs193922179, rs1597581005, rs1597593736, rs1597623670, rs1597625734, rs1597631662, rs113604459, rs1597633183, rs1597633219, rs1597518951, rs1555394781, rs1597525871, rs1597526073, rs1597569159, rs1597569536, rs1597563934, rs1597545199, rs1364210063, rs1597552583, rs1597520619, rs1597540854, rs1597591602, rs1597569551, rs1597548716, rs1597553721, rs112728248, rs1597537858, rs1597517935, rs1597540907, rs1597552388, rs1597591643, rs1597529841, rs1597506547, rs1597509836, rs1597529686, rs1566897404, rs1597533713, rs1597543486, rs1597545257, rs1597545345, rs1597548672, rs1597562812, rs1597563287, rs1597571391, rs1555400052, rs1597583989, rs363852, rs1597547226, rs363808, rs974604498, rs2043595650, rs2043526284, rs2042997306, rs1555397195, rs886039054, rs1555397213, rs2042873946	19385967, 23624423
Medulloblastoma	Medulloblastoma, Childhood Medulloblastoma, Adult Medulloblastoma, Desmoplastic Medulloblastoma, Melanotic medulloblastoma	rs1589970134, rs587776578, rs587776579, rs17847577, rs111033171, rs80359604, rs80358785, rs80358814, rs863224925, rs1555950011, rs1554231278, rs926177767, rs759412460, rs1564032829, rs761911009	19270706
Ovarian cancer	Malignant neoplasm of ovary	rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828, rs80357208, rs55770810, rs80358165, rs80358010, rs587780226, rs536907995, rs139414606, rs371638537, rs574552037, rs730881647, rs747993448, rs786202125, rs786202962, rs121913321, rs189261858, rs869320800, rs753023295, rs779466229, rs752411477, rs80357438, rs191486604, rs760874290, rs752780954, rs760782298, rs1555591361, rs1555578360, rs1555588460, rs1555587401, rs747427602, rs112675807, rs80357393	21397856
Ovarian carcinoma	Ovarian Carcinoma	rs62625308, rs137886232, rs397507192, rs80357609, rs397508926, rs80357223, rs80357678, rs587779243, rs587782861, rs747539984, rs876658381

Unknown
Disease term	Disease name	Evidence	References	Source
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients		GWAS, CBGDA
Metabolic Syndrome	Metabolic Syndrome			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Abnormalities Drug Induced	Associate	27463019
Adenocarcinoma	Associate	32387455, 36803948
Adenosarcoma	Associate	36138078
Adrenocortical Carcinoma	Associate	27165744
Anemia	Associate	33662100
Breast Neoplasms	Associate	15606925, 18174243, 19242061, 19777567, 20473280, 20607601, 22433433, 22564522, 23139263, 23185313, 24194916, 25732226, 25830480, 28797035, 30358191, 30807234, 31078043, 33307492, 33313822, 35186236, 35383130, 36749874, 37303942, 37801505, 38625790
Carcinogenesis	Associate	24098334, 24366882, 28760857, 36964635
Carcinoid Tumor	Associate	26008974
Carcinoma Basal Cell	Stimulate	19470724
Carcinoma Endometrioid	Associate	26647729
Carcinoma Hepatocellular	Associate	23544130, 23867110, 28844099, 29487225, 31363003, 31375600, 33390802, 33557409, 35236936, 35694386
Carcinoma in Situ	Associate	27443516
Carcinoma Neuroendocrine	Associate	36653904
Carcinoma Non Small Cell Lung	Associate	27463019, 31962276, 35422093, 35431233, 35499228, 37864031
Carcinoma Ovarian Epithelial	Associate	19032793, 29228869, 33863809
Carcinoma Renal Cell	Associate	28718916, 30675171, 31259714, 32986937
Carcinoma Squamous Cell	Associate	29749538, 33833226
Carcinosarcoma	Associate	37651310, 38536067
Chromosomal Instability	Associate	28760857
Chromosomal Instability	Stimulate	33290867, 33731859
Colorectal Neoplasms	Associate	27527859
Death	Associate	23900874
Disease	Associate	23900874, 39355617
DNA Repair Deficiency Disorders	Associate	33662100
Dwarfism	Associate	30281379
Endometrial Neoplasms	Stimulate	24309323
Endometrial Neoplasms	Associate	26647729, 27582547, 36964635, 38564163
Epilepsy Idiopathic Generalized	Associate	30675171
Familial cylindromatosis	Associate	32032585
Fatigue	Associate	33662100
Glioblastoma	Associate	20164239, 22291905
Glioma	Associate	30273182, 30548945
Gliosarcoma	Associate	38097740
Glutamate Monosodium Sensitivity	Associate	33262572
Hemangioma	Associate	21179471
Hepatitis E	Associate	36749874
Hypoxia	Stimulate	29426911
Inflammation	Associate	37737195
Intracranial Hypertension	Associate	36964635
Kidney Failure Chronic	Associate	27767100
Kidney Neoplasms	Stimulate	37310408
Labor Pain	Associate	28847437
Leukemia B Cell	Associate	19454496
Liver Failure	Associate	37863651
Lung Diseases	Associate	24671051
Lung Neoplasms	Stimulate	25124555
Lung Neoplasms	Associate	31962276, 32338437, 35422093, 39905556
Lymphatic Metastasis	Associate	23185313, 26647729
Lymphatic Metastasis	Stimulate	31072916
Lymphoma Large B Cell Diffuse	Associate	19454496
Lymphoma Mantle Cell	Associate	30538135
Lymphoma Non Hodgkin	Associate	32801341, 36572991
Male Infertility with Large Headed Multiflagellar Polyploid Spermatozoa	Associate	24803180
Mesothelioma Malignant	Associate	36139498
Mohr Tranebjaerg syndrome	Associate	35184425
Multiple Myeloma	Associate	22558078, 30975979, 37012388
Myoepithelioma	Inhibit	25223915
Nasopharyngeal Carcinoma	Associate	25337187, 35303867
Nausea	Associate	33662100
Neoplasm Metastasis	Associate	37131253
Neoplasms	Associate	15166955, 19193619, 19470724, 19777567, 19944013, 19995430, 20473280, 21179471, 21720365, 22174824, 22433433, 22723937, 23185313, 23324395, 23544130, 23900874, 24071852, 24218601, 25372287, 26008974, 26057453, 26392535, 26569395, 27443516, 27444036, 27463019, 27527859, 27605415, 27663592, 27694442, 28760857, 28776571, 30300578, 30665374, 30675171, 31962276, 32152520, 32299473, 32801341, 33436485, 33511732, 33969640, 35091678, 35138918, 35395071, 35444283, 35732503, 36681079, 36749874, 36803948, 36964635, 37067201, 37303942, 37506248, 38564163, 38625790
Neoplasms	Inhibit	31657115
Neoplasms	Stimulate	35430569
Neoplasms Cystic Mucinous and Serous	Associate	24309323, 27443516, 33602681
Neoplasms Cystic Mucinous and Serous	Stimulate	35002543
Neuroblastoma	Associate	22120721, 35655142
Neuroendocrine Tumors	Associate	33522043, 36653904
Non Muscle Invasive Bladder Neoplasms	Associate	28082741
Oncogene Addiction	Stimulate	22685613
Osteosarcoma	Associate	26510912, 32162720
Ovarian Diseases	Stimulate	38097740
Ovarian Neoplasms	Associate	19193619, 19258477, 20336784, 21103391, 22174824, 23517670, 23990444, 24366882, 26823747, 27443516, 27444036, 27663592, 27767100, 29724815, 31060523, 31657115, 31709901, 32044108, 32415712, 33290867, 33432021, 33731859, 34734085, 35444283, 35696721, 35732503, 36289203, 36572991, 36805789, 36964635
Ovarian Neoplasms	Stimulate	32295618
Pancreatic Neoplasms	Associate	24041470
Pancreatitis Chronic	Associate	15166955
Parkinson Disease	Associate	32868381
Periostitis	Associate	32299473
Personality Disorders	Associate	25320178, 33969640
Pituitary dwarfism 1	Associate	30281379
Pre Eclampsia	Associate	23083510
Prostatic Neoplasms	Associate	30237511, 33522043, 35430569
Rectal Neoplasms	Associate	25973052, 30809467
Respiratory Tract Infections	Associate	25408144
Retinoblastoma	Associate	26191215
Salivary Duct Calculi	Associate	30946933
Skin Diseases	Associate	37863651
Small Cell Lung Carcinoma	Associate	35184425, 37062002
Squamous Cell Carcinoma of Head and Neck	Associate	39738469
ST Elevation Myocardial Infarction	Associate	30382883
Stomach Neoplasms	Associate	16575401, 25372287, 27864121, 29884122, 31072916, 32461621, 33262572, 33511732, 37863651
Tertiary Lymphoid Structures	Associate	31055034
Thyroid Carcinoma Anaplastic	Associate	29615459
Thyroid Neoplasms	Associate	18701481
Triple Negative Breast Neoplasms	Associate	30621700, 30665374, 35091678
Triple Negative Breast Neoplasms	Stimulate	33757543
Urinary Bladder Neoplasms	Associate	18008359, 20972438, 25320178, 26057453, 26966728, 27514407, 29028944, 30279572, 35759030
Uterine Cervical Neoplasms	Associate	33413211, 35126958
Uterine Cervicitis	Associate	33413211
Uterine Neoplasms	Associate	35444283