CCNA1 (cyclin A1)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8900
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclin A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCNA1
Synonyms (NCBI Gene) Gene synonyms aliases
CT146
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT006767 hsa-miR-372-3p FACS, GFP reporter assay, qRT-PCR, Western blot 21646351
MIRT006767 hsa-miR-372-3p FACS, GFP reporter assay, qRT-PCR, Western blot 21646351
MIRT018229 hsa-miR-335-5p Microarray 18185580
MIRT022823 hsa-miR-124-3p Microarray 18668037
MIRT032444 hsa-let-7b-5p Reporter assay 18379589
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
Transcription factor Regulation Reference
ATF1 Repression 12044952
CREM Unknown 7760825
KDM4B Unknown 20682797
MYB Activation 10590070
MYBL2 Unknown 11264176;15922873
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(18)
GO ID Ontology Definition Evidence Reference
GO:0000079 Process Regulation of cyclin-dependent protein serine/threonine kinase activity IBA 21873635
GO:0000083 Process Regulation of transcription involved in G1/S transition of mitotic cell cycle TAS
GO:0000307 Component Cyclin-dependent protein kinase holoenzyme complex IBA 21873635
GO:0005515 Function Protein binding IPI 8756624, 15159402, 15232106, 18692475, 21540187, 25241761, 29997244, 32814053
GO:0005634 Component Nucleus IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604036 1577 ENSG00000133101
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P78396
Protein name Cyclin-A1
Protein function May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic c
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 214 → 340 Cyclin, N-terminal domain Domain
PF02984 Cyclin_C 342 → 459 Cyclin, C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines. {ECO:0000269|PubMed:9041194}.
Sequence 
METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVA
RGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKK
ALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFN
TVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT
EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY
EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVR
TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV
PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
Sequence length 465
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cell cycle
AMPK signaling pathway
Cellular senescence
Progesterone-mediated oocyte maturation
Hepatitis B
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Acute myeloid leukemia 		  G0 and Early G1
Phosphorylation of proteins involved in the G2/M transition by Cyclin A:Cdc2 complexes
Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Regulation of APC/C activators between G1/S and early anaphase
SCF(Skp2)-mediated degradation of p27/p21
Senescence-Associated Secretory Phenotype (SASP)
DNA Damage/Telomere Stress Induced Senescence
Ub-specific processing proteases
Processing of DNA double-strand break ends
TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest
Regulation of TP53 Activity through Phosphorylation
Regulation of TP53 Degradation
G2 Phase
Orc1 removal from chromatin
CDK-mediated phosphorylation and removal of Cdc6
G1/S-Specific Transcription
Cyclin A/B1/B2 associated events during G2/M transition
p53-Dependent G1 DNA Damage Response
Cyclin A:Cdk2-associated events at S phase entry
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Carcinoma of the head and neck Squamous cell carcinoma of the head and neck rs121909237, rs121909250, rs121909251, rs121909252, rs28934571, rs28934574, rs28934576, rs28934578, rs121912664, rs397516436, rs121912666, rs397514495, rs587782705, rs193920774, rs730882001
View all (7 more)		 23358896, 29464035
Show/Hide Text Mining Associations (53)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32998690
Astrocytoma Associate 15367334
Atypical Squamous Cells of the Cervix Associate 32102526
Barrett Esophagus Associate 29343623
Brain Neoplasms Associate 24359512
Breast Neoplasms Associate 27110560
Carcinogenesis Associate 20208141, 21646351, 37684649
Carcinoma Non Small Cell Lung Associate 16799873
Carcinoma Ovarian Epithelial Associate 26499264
Carcinoma Renal Cell Associate 16799873, 24980822