Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	8900
Gene name	Cyclin A1
Gene symbol	CCNA1
Synonyms (NCBI Gene)	CT146
Chromosome	13
Chromosome location	13q13.3
Summary	The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit

Show/Hide all (5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006767	hsa-miR-372-3p	FACSGFP reporter assayqRT-PCRWestern blot	21646351
MIRT006767	hsa-miR-372-3p	FACSGFP reporter assayqRT-PCRWestern blot	21646351
MIRT018229	hsa-miR-335-5p	Microarray	18185580
MIRT022823	hsa-miR-124-3p	Microarray	18668037
MIRT032444	hsa-let-7b-5p	Reporter assay	18379589

Show/Hide all (7)

Transcription factor	Regulation	Reference
ATF1	Repression	12044952
CREM	Unknown	7760825
KDM4B	Unknown	20682797
MYB	Activation	10590070
MYBL2	Unknown	11264176;15922873
RARA	Repression	11090075
TP53	Unknown	17530187

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0005515	Function	Protein binding	IPI	8756624, 15159402, 15232106, 18692475, 21540187, 25241761, 29997244, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	TAS	9041194
GO:0007141	Process	Male meiosis I	TAS	9843212
GO:0007283	Process	Spermatogenesis	TAS	9843212
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0051301	Process	Cell division	IEA
GO:0097121	Component	Cyclin A1-CDK1 complex	NAS	19592082
GO:0097123	Component	Cyclin A1-CDK2 complex	IEA
GO:0097123	Component	Cyclin A1-CDK2 complex	NAS	12244298
GO:0097124	Component	Cyclin A2-CDK2 complex	IBA

MIM	HGNC	e!Ensembl
604036	1577	ENSG00000133101

P78396

Protein name

Cyclin-A1

Protein function

May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic c

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00134	Cyclin_N	214 → 340	Cyclin, N-terminal domain	Domain
PF02984	Cyclin_C	342 → 459	Cyclin, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines. {ECO:0000269|PubMed:9041194}.

Sequence

METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVA
RGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKK
ALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFN
TVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT
EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY
EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVR
TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV
PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ

Sequence length

465

Interactions

View interactions

	KEGG		Reactome
	Cell cycle AMPK signaling pathway Cellular senescence Progesterone-mediated oocyte maturation Hepatitis B Human papillomavirus infection Human T-cell leukemia virus 1 infection Epstein-Barr virus infection Pathways in cancer Transcriptional misregulation in cancer Viral carcinogenesis Acute myeloid leukemia		G0 and Early G1 Phosphorylation of proteins involved in the G2/M transition by Cyclin A:Cdc2 complexes Cdc20:Phospho-APC/C mediated degradation of Cyclin A Regulation of APC/C activators between G1/S and early anaphase SCF(Skp2)-mediated degradation of p27/p21 Senescence-Associated Secretory Phenotype (SASP) DNA Damage/Telomere Stress Induced Senescence Ub-specific processing proteases Processing of DNA double-strand break ends TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest Regulation of TP53 Activity through Phosphorylation Regulation of TP53 Degradation G2 Phase Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 G1/S-Specific Transcription Cyclin A/B1/B2 associated events during G2/M transition p53-Dependent G1 DNA Damage Response Cyclin A:Cdk2-associated events at S phase entry

CCNA1 (cyclin A1)