Gene Gene information from NCBI Gene database.
Entrez ID 8894
Gene name Eukaryotic translation initiation factor 2 subunit beta
Gene symbol EIF2S2
Synonyms (NCBI Gene)
EIF2EIF2BEIF2betaPPP1R67eIF-2-beta
Chromosome 20
Chromosome location 20q11.22
Summary Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gam
miRNA miRNA information provided by mirtarbase database.
211
miRTarBase ID miRNA Experiments Reference
MIRT021922 hsa-miR-128-3p Sequencing 20371350
MIRT022382 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT028733 hsa-miR-27a-3p Sequencing 20371350
MIRT044047 hsa-miR-363-3p CLASH 23622248
MIRT562422 hsa-miR-3681-3p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development IEA
GO:0001731 Process Formation of translation preinitiation complex IBA
GO:0002176 Process Male germ cell proliferation IEA
GO:0002183 Process Cytoplasmic translational initiation IMP 31836389
GO:0003723 Function RNA binding HDA 22658674, 22681889
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603908 3266 ENSG00000125977
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P20042
Protein name Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 subunit beta) (eIF2-beta)
Protein function Component of the eIF2 complex that functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA (PubMed:31836389). This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form the
PDB 6K71 , 6K72 , 6YBV , 6ZMW , 6ZP4 , 7A09 , 7D43 , 7QP6 , 8OZ0 , 8PJ1 , 8PPL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01873 eIF-5_eIF-2B 192 308 Domain found in IF2B/IF5 Family
Sequence
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEED
TRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIM
LGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELL
NRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFL
LAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
QCETCHSR
CSVASIKTGFQAVTGKRAQLRAKAN
Sequence length 333
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    L13a-mediated translational silencing of Ceruloplasmin expression
PERK regulates gene expression
ABC-family proteins mediated transport
Translation initiation complex formation
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit
Recycling of eIF2:GDP