Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8875
Gene name	Vanin 2
Gene symbol	VNN2
Synonyms (NCBI Gene)	FOAP-4GPI-80
Chromosome	6
Chromosome location	6q23.2
Summary	This gene product is a member of the Vanin family of proteins that share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to particip

Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016760	hsa-miR-335-5p	Microarray	18185580
MIRT022124	hsa-miR-124-3p	Microarray	18668037
MIRT028816	hsa-miR-26b-5p	Microarray	19088304
MIRT1485707	hsa-miR-1236	CLIP-seq
MIRT1485708	hsa-miR-2467-5p	CLIP-seq
MIRT1485709	hsa-miR-3135b	CLIP-seq
MIRT1485710	hsa-miR-3188	CLIP-seq
MIRT1485711	hsa-miR-3652	CLIP-seq
MIRT1485712	hsa-miR-3975	CLIP-seq
MIRT1485713	hsa-miR-4430	CLIP-seq
MIRT1485714	hsa-miR-4487	CLIP-seq
MIRT1485715	hsa-miR-4633-3p	CLIP-seq
MIRT1485716	hsa-miR-4653-3p	CLIP-seq
MIRT1485717	hsa-miR-4729	CLIP-seq
MIRT1485718	hsa-miR-4753-3p	CLIP-seq
MIRT1485719	hsa-miR-485-5p	CLIP-seq
MIRT1485720	hsa-miR-579	CLIP-seq
MIRT2366500	hsa-miR-1272	CLIP-seq
MIRT2366501	hsa-miR-1322	CLIP-seq
MIRT2366502	hsa-miR-298	CLIP-seq
MIRT2366503	hsa-miR-3157-5p	CLIP-seq
MIRT2366504	hsa-miR-4691-3p	CLIP-seq
MIRT1485707	hsa-miR-1236	CLIP-seq
MIRT1485718	hsa-miR-4753-3p	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0015939	Process	Pantothenate metabolic process	IBA
GO:0015939	Process	Pantothenate metabolic process	IDA	11491533
GO:0015939	Process	Pantothenate metabolic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016811	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IEA
GO:0017159	Function	Pantetheine hydrolase activity	IBA
GO:0017159	Function	Pantetheine hydrolase activity	IDA	11491533
GO:0017159	Function	Pantetheine hydrolase activity	IEA
GO:0017159	Function	Pantetheine hydrolase activity	TAS
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
603571	12706	ENSG00000112303

O95498

Protein name

Pantetheine hydrolase VNN2 (EC 3.5.1.92) (Glycosylphosphatidyl inositol-anchored protein GPI-80) (Protein FOAP-4) (Vascular non-inflammatory molecule 2) (Vanin-2)

Protein function

Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine (PubMed:11491533). Involved in the thymus homing of bone marrow cells. May regulate

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00795	CN_hydrolase	51 → 262	Carbon-nitrogen hydrolase	Family
PF19018	Vanin_C	337 → 487	Vanin C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with higher expression in spleen and blood. {ECO:0000269|PubMed:19322213}.

Sequence

MVTSSFPISVAVFALITLQVGTQDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDI
LETAIKQAAEQGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTP
VQARLSCLAKDNSIYVLANLGDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKY
HLYSEPQFNVPEKPELVTFNTAFGRFGIFTCFDIFFYDPGVTLVKDFHVDTILFPTAWMN
VLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIYAPNGPKVYHYDMKTELGKLL
LSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTV
CQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTLLKCKTTNLTTCGRPVE
TASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLF
GRWYTKDSLYSSCGTSNSAITYLLIFILLMIIALQNIVML

Sequence length

520

Interactions

View interactions

	KEGG		Reactome
	Pantothenate and CoA biosynthesis Metabolic pathways		Post-translational modification: synthesis of GPI-anchored proteins Vitamin B5 (pantothenate) metabolism

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Prostate cancer	Uncertain significance	rs864622023	RCV000206245

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	12237255, 17453718
Brain Neoplasms	Inhibit	32823285
Bronchopulmonary Dysplasia	Associate	34465876
Clear cell metastatic renal cell carcinoma	Associate	31776298
Diabetes Mellitus	Associate	37773841
Esophageal Squamous Cell Carcinoma	Associate	12901795
Glioma	Associate	34953280
Inflammation	Associate	30826088, 32853382
Inflammatory Bowel Diseases	Stimulate	17453718
Leukemia Myeloid	Associate	31776298
Neoplasm Metastasis	Associate	32823285
Neoplasms	Associate	31776298, 34769456
Periodontitis	Stimulate	36527111
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	32853382
Prostatic Neoplasms	Associate	34769456
Radiation Injuries	Associate	32823285
Sjogren's Syndrome	Stimulate	35309355
Tetra amelia with ectodermal dysplasia and lacrimal duct abnormalities	Associate	32853382
Thymoma	Associate	12967480

VNN2 (vanin 2)