Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8870
Gene name Gene Name - the full gene name approved by the HGNC.
Immediate early response 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IER3
Synonyms (NCBI Gene) Gene synonyms aliases
DIF-2, DIF2, GLY96, IEX-1, IEX-1L, IEX1, PRG1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene functions in the protection of cells from Fas- or tumor necrosis factor type alpha-induced apoptosis. Partially degraded and unspliced transcripts are found after virus infection in vitro, but these transcripts are not found in vivo and do not g
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004200 hsa-miR-197-3p Microarray 16822819
MIRT027607 hsa-miR-98-5p Microarray 19088304
MIRT722053 hsa-miR-499b-5p HITS-CLIP 19536157
MIRT722052 hsa-miR-6729-3p HITS-CLIP 19536157
MIRT722050 hsa-miR-7977 HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
HOXA1 Unknown 17213808
MYC Unknown 12360408
NFKB1 Unknown 12360408
REL Unknown 12360408
RELA Unknown 12360408
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15451437, 16456541, 18191642, 32296183
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IDA 20467439
GO:0005829 Component Cytosol TAS
GO:0006915 Process Apoptotic process TAS 9196025
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602996 5392 ENSG00000137331
Protein
UniProt ID P46695
Protein name Radiation-inducible immediate-early gene IEX-1 (Differentiation-dependent gene 2 protein) (Protein DIF-2) (Immediate early protein GLY96) (Immediate early response 3 protein) (PACAP-responsive gene 1 protein) (Protein PRG1)
Protein function May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. Also acts as an ERK downstream effector mediating survival. As a member of the NUPR1/RELB/IER3 survival pathway, may
Family and domains
Sequence
MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRK
RSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASL
APTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF
Sequence length 156
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Irritant rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 27258892
Hypertension Hypertensive disease rs13306026 20713914
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Stimulate 26986830
Adenocarcinoma of Lung Associate 26986830
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis Stimulate 12371964
Arthritis Rheumatoid Associate 27736946, 27898717
Carcinogenesis Associate 23534784, 25684507, 26986830, 27736946
Carcinoma Hepatocellular Associate 27336713, 35291486, 37354485
Carcinoma Ovarian Epithelial Associate 29431239
Cardiomegaly Associate 15451437
Crohn Disease Associate 38001042
Glomerulonephritis IGA Associate 36709307