Gene Gene information from NCBI Gene database.
Entrez ID 8870
Gene name Immediate early response 3
Gene symbol IER3
Synonyms (NCBI Gene)
DIF-2DIF2GLY96IEX-1IEX-1LIEX1PRG1
Chromosome 6
Chromosome location 6p21.33
Summary This gene functions in the protection of cells from Fas- or tumor necrosis factor type alpha-induced apoptosis. Partially degraded and unspliced transcripts are found after virus infection in vitro, but these transcripts are not found in vivo and do not g
miRNA miRNA information provided by mirtarbase database.
451
miRTarBase ID miRNA Experiments Reference
MIRT004200 hsa-miR-197-3p Microarray 16822819
MIRT027607 hsa-miR-98-5p Microarray 19088304
MIRT722053 hsa-miR-499b-5p HITS-CLIP 19536157
MIRT722052 hsa-miR-6729-3p HITS-CLIP 19536157
MIRT722050 hsa-miR-7977 HITS-CLIP 19536157
Transcription factors Transcription factors information provided by TRRUST V2 database.
6
Transcription factor Regulation Reference
HOXA1 Unknown 17213808
MYC Unknown 12360408
NFKB1 Unknown 12360408
REL Unknown 12360408
RELA Unknown 12360408
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0001562 Process Response to protozoan IEA
GO:0003085 Process Negative regulation of systemic arterial blood pressure IEA
GO:0005515 Function Protein binding IPI 15451437, 16456541, 18191642, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 20467439
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602996 5392 ENSG00000137331
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P46695
Protein name Radiation-inducible immediate-early gene IEX-1 (Differentiation-dependent gene 2 protein) (Protein DIF-2) (Immediate early protein GLY96) (Immediate early response 3 protein) (PACAP-responsive gene 1 protein) (Protein PRG1)
Protein function May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. Also acts as an ERK downstream effector mediating survival. As a member of the NUPR1/RELB/IER3 survival pathway, may
Family and domains
Sequence
MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRK
RSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASL
APTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF
Sequence length 156
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling