Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	887
Gene name Gene Name - the full gene name approved by the HGNC.	Cholecystokinin B receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCKBR
Synonyms (NCBI Gene) Gene synonyms aliases	CCK-2R, CCK-B, CCK2R, GASR
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK a

Show/Hide all(44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005759	hsa-miR-148b-3p	Luciferase reporter assay	21205300
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, Microarray	21168126
MIRT005759	hsa-miR-148b-3p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	22020560
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23975374
MIRT005898	hsa-miR-148a-3p	qRT-PCR, Western blot	20422307
MIRT053380	hsa-miR-152-3p	qRT-PCR, Western blot	20422307
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT870845	hsa-miR-1231	CLIP-seq
MIRT870846	hsa-miR-1299	CLIP-seq
MIRT870847	hsa-miR-148a	CLIP-seq
MIRT870848	hsa-miR-148b	CLIP-seq
MIRT870849	hsa-miR-152	CLIP-seq
MIRT870850	hsa-miR-298	CLIP-seq
MIRT870851	hsa-miR-3185	CLIP-seq
MIRT870852	hsa-miR-3202	CLIP-seq
MIRT870853	hsa-miR-4276	CLIP-seq
MIRT870854	hsa-miR-4533	CLIP-seq
MIRT870855	hsa-miR-4697-3p	CLIP-seq
MIRT870856	hsa-miR-4773	CLIP-seq
MIRT870857	hsa-miR-548b-3p	CLIP-seq
MIRT870858	hsa-miR-616	CLIP-seq
MIRT870859	hsa-miR-875-3p	CLIP-seq
MIRT1546244	hsa-miR-202	CLIP-seq
MIRT1546245	hsa-miR-4257	CLIP-seq
MIRT870847	hsa-miR-148a	CLIP-seq
MIRT870848	hsa-miR-148b	CLIP-seq
MIRT870849	hsa-miR-152	CLIP-seq
MIRT870853	hsa-miR-4276	CLIP-seq
MIRT1958597	hsa-miR-509-3p	CLIP-seq
MIRT1958598	hsa-miR-512-3p	CLIP-seq
MIRT1958599	hsa-miR-592	CLIP-seq
MIRT1958600	hsa-miR-597	CLIP-seq
MIRT870847	hsa-miR-148a	CLIP-seq
MIRT870848	hsa-miR-148b	CLIP-seq
MIRT870849	hsa-miR-152	CLIP-seq
MIRT1546245	hsa-miR-4257	CLIP-seq
MIRT870853	hsa-miR-4276	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001696	Process	Gastric acid secretion	IEA
GO:0004951	Function	Cholecystokinin receptor activity	IDA	7681836
GO:0005515	Function	Protein binding	IPI	16963136, 23597562, 25416956
GO:0005886	Component	Plasma membrane	TAS
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	10913157
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	7681836
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	10913157
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10913157
GO:0015054	Function	Gastrin receptor activity	IDA	7681836, 10913157
GO:0016021	Component	Integral component of membrane	IEA
GO:0017046	Function	Peptide hormone binding	IPI	7681836
GO:0031741	Function	Type B gastrin/cholecystokinin receptor binding	IDA	1280419, 8185642
GO:0038188	Process	Cholecystokinin signaling pathway	IDA	7681836
GO:0043551	Process	Regulation of phosphatidylinositol 3-kinase activity	IEA
GO:0045851	Process	PH reduction	IEA
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	TAS	10400698
GO:0048565	Process	Digestive tract development	IEA
GO:0048732	Process	Gland development	IEA

MIM	HGNC	e!Ensembl
118445	1571	ENSG00000110148

Protein

UniProt ID

P32239

Protein name

Gastrin/cholecystokinin type B receptor (CCK-B receptor) (CCK-BR) (Cholecystokinin-2 receptor) (CCK2-R)

Protein function

Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins

PDB

1L4T , 7F8V , 7F8W , 7XOW , 8IA7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	71 → 390	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at hig

Sequence

MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL
YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL
ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS
RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG
PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL
PDEDPPTPSIASLSRLSYTTISTLGPG

Sequence length

447

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Gastric acid secretion		Peptide ligand-binding receptors G alpha (q) signalling events Gastrin-CREB signalling pathway via PKC and MAPK

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	Source
Unknown
Gastroesophageal Reflux Disease	Gastroesophageal Reflux Disease		GWAS
Rheumatic Heart Disease	Rheumatic Heart Disease		GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA
Restless Legs Syndrome	Restless Legs Syndrome		GWAS
Duodenal Ulcer	Duodenal Ulcer		GWAS

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	11076881, 28980157
Anxiety	Associate	28413930
Carcinogenesis	Associate	11896205, 15929170, 25752269, 26508021, 36871090
Carcinoid Tumor	Associate	18719002, 26910279
Carcinoma Small Cell	Associate	7928627
Colonic Neoplasms	Associate	11076881, 26508021, 7928627
Colonic Polyps	Associate	11076881
Colorectal Neoplasms	Associate	15292208, 15655524, 17167838, 19627395, 34740325, 35722465
Duodenal Ulcer	Associate	33608531
Esophageal Squamous Cell Carcinoma	Associate	18438722
Gallbladder Neoplasms	Associate	36871090
Gastritis	Associate	30382864
Gastrointestinal Neoplasms	Associate	11896205, 20932834, 9691917
Leukemia	Associate	8839863
Lung Neoplasms	Associate	19627395
Lung Neoplasms	Stimulate	26910279
Melanoma	Associate	38069171
Mental Disorders	Associate	26608796
Microsatellite Instability	Associate	11896205
Morphine Dependence	Associate	22682150
Neoplasms	Associate	11896205, 19627395, 22442157, 25469546, 26910279, 28980157, 38069171, 7928627
Neuroendocrine Tumors	Associate	26910279
Ovarian Neoplasms	Associate	26910279
Pain	Associate	33530940
Pancreatic Neoplasms	Associate	15682471, 22277584, 23975374, 25469546, 26646278, 9239407
Pancreatic Neoplasms	Stimulate	22442157
Pancreatic Neoplasms	Inhibit	27072272
Peptic Ulcer	Associate	33608531
Polyps	Associate	11076881
Small Cell Lung Carcinoma	Associate	7928627
Stiff Person Syndrome	Associate	26608796
Stomach Neoplasms	Associate	11192946, 18719002, 20150185, 23121767, 27072272, 28109268, 30607886, 8662934
Stomach Neoplasms	Stimulate	15929170
Thyroid cancer medullary	Associate	26884118, 36657979
Thyroid Neoplasms	Associate	26910279
Thyroiditis	Associate	26910279

CCKBR (cholecystokinin B receptor)