Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	8862
Gene name	Apelin
Gene symbol	APLN
Synonyms (NCBI Gene)	APELXNPEP2
Chromosome	X
Chromosome location	Xq26.1
Summary	This gene encodes a peptide that functions as an endogenous ligand for the G-protein coupled apelin receptor. The encoded preproprotein is proteolytically processed into biologically active C-terminal peptide fragments. These peptide fragments activate di

152

Show/Hide all (152)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047924	hsa-miR-30c-5p	CLASH	23622248
MIRT046134	hsa-miR-30b-5p	CLASH	23622248
MIRT573091	hsa-miR-6729-3p	PAR-CLIP	20371350
MIRT573092	hsa-miR-4286	PAR-CLIP	20371350
MIRT573090	hsa-miR-361-3p	PAR-CLIP	20371350
MIRT573089	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT573088	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT573086	hsa-miR-6734-3p	PAR-CLIP	20371350
MIRT573087	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT573085	hsa-miR-4713-5p	PAR-CLIP	20371350
MIRT573084	hsa-miR-6867-3p	PAR-CLIP	20371350
MIRT573083	hsa-miR-629-3p	PAR-CLIP	20371350
MIRT731163	hsa-miR-224-5p	Luciferase reporter assayqRT-PCRMicroarrayWestern blot	25532941
MIRT731163	hsa-miR-224-5p	Luciferase reporter assayqRT-PCRMicroarrayWestern blot	25532941
MIRT732457	hsa-miR-193b-5p	Immunohistochemistry (IHC)Luciferase reporter assayWestern blotting	32803505
MIRT733005	hsa-miR-124-3p	Luciferase reporter assay	32692577
MIRT734275	hsa-miR-424-5p	ELISAWestern blottingLuciferase reporter assayqRT-PCR	32774725
MIRT734275	hsa-miR-424-5p	ELISAWestern blottingLuciferase reporter assayqRT-PCR	32774725
MIRT734777	hsa-miR-182-5p	Luciferase reporter assayWestern blottingqRT-PCR	32099369
MIRT573091	hsa-miR-6729-3p	PAR-CLIP	20371350
MIRT573092	hsa-miR-4286	PAR-CLIP	20371350
MIRT573090	hsa-miR-361-3p	PAR-CLIP	20371350
MIRT573089	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT573088	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT573086	hsa-miR-6734-3p	PAR-CLIP	20371350
MIRT573087	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT573085	hsa-miR-4713-5p	PAR-CLIP	20371350
MIRT573084	hsa-miR-6867-3p	PAR-CLIP	20371350
MIRT573083	hsa-miR-629-3p	PAR-CLIP	20371350
MIRT789551	hsa-miR-103a	CLIP-seq
MIRT789552	hsa-miR-107	CLIP-seq
MIRT789553	hsa-miR-1207-3p	CLIP-seq
MIRT789554	hsa-miR-15a	CLIP-seq
MIRT789555	hsa-miR-15b	CLIP-seq
MIRT789556	hsa-miR-16	CLIP-seq
MIRT789557	hsa-miR-195	CLIP-seq
MIRT789558	hsa-miR-296-5p	CLIP-seq
MIRT789559	hsa-miR-3115	CLIP-seq
MIRT789560	hsa-miR-3155	CLIP-seq
MIRT789561	hsa-miR-3155b	CLIP-seq
MIRT789562	hsa-miR-3183	CLIP-seq
MIRT789563	hsa-miR-3675-5p	CLIP-seq
MIRT789564	hsa-miR-424	CLIP-seq
MIRT789565	hsa-miR-4435	CLIP-seq
MIRT789566	hsa-miR-4488	CLIP-seq
MIRT789567	hsa-miR-4503	CLIP-seq
MIRT789568	hsa-miR-4524	CLIP-seq
MIRT789569	hsa-miR-4684-5p	CLIP-seq
MIRT789570	hsa-miR-4697-5p	CLIP-seq
MIRT789571	hsa-miR-4723-3p	CLIP-seq
MIRT789572	hsa-miR-4749-3p	CLIP-seq
MIRT789573	hsa-miR-484	CLIP-seq
MIRT789574	hsa-miR-486-3p	CLIP-seq
MIRT789575	hsa-miR-497	CLIP-seq
MIRT789576	hsa-miR-503	CLIP-seq
MIRT789577	hsa-miR-646	CLIP-seq
MIRT789566	hsa-miR-4488	CLIP-seq
MIRT789570	hsa-miR-4697-5p	CLIP-seq
MIRT789574	hsa-miR-486-3p	CLIP-seq
MIRT1555963	hsa-miR-125a-5p	CLIP-seq
MIRT1555964	hsa-miR-125b	CLIP-seq
MIRT1555965	hsa-miR-3136-3p	CLIP-seq
MIRT1555966	hsa-miR-3153	CLIP-seq
MIRT1555967	hsa-miR-4319	CLIP-seq
MIRT789566	hsa-miR-4488	CLIP-seq
MIRT1555968	hsa-miR-4493	CLIP-seq
MIRT1555969	hsa-miR-4697-3p	CLIP-seq
MIRT789570	hsa-miR-4697-5p	CLIP-seq
MIRT1555970	hsa-miR-4732-3p	CLIP-seq
MIRT1555971	hsa-miR-670	CLIP-seq
MIRT1932910	hsa-miR-1237	CLIP-seq
MIRT1932911	hsa-miR-1248	CLIP-seq
MIRT1932912	hsa-miR-1287	CLIP-seq
MIRT1932913	hsa-miR-137	CLIP-seq
MIRT1932914	hsa-miR-1587	CLIP-seq
MIRT789554	hsa-miR-15a	CLIP-seq
MIRT789555	hsa-miR-15b	CLIP-seq
MIRT789556	hsa-miR-16	CLIP-seq
MIRT789557	hsa-miR-195	CLIP-seq
MIRT789558	hsa-miR-296-5p	CLIP-seq
MIRT789562	hsa-miR-3183	CLIP-seq
MIRT1932915	hsa-miR-3667-3p	CLIP-seq
MIRT1932916	hsa-miR-3921	CLIP-seq
MIRT789564	hsa-miR-424	CLIP-seq
MIRT1932917	hsa-miR-4303	CLIP-seq
MIRT1932918	hsa-miR-4468	CLIP-seq
MIRT1932919	hsa-miR-4492	CLIP-seq
MIRT1932920	hsa-miR-4498	CLIP-seq
MIRT789567	hsa-miR-4503	CLIP-seq
MIRT1932921	hsa-miR-4522	CLIP-seq
MIRT1932922	hsa-miR-4653-5p	CLIP-seq
MIRT789569	hsa-miR-4684-5p	CLIP-seq
MIRT1932923	hsa-miR-4714-5p	CLIP-seq
MIRT789571	hsa-miR-4723-3p	CLIP-seq
MIRT789572	hsa-miR-4749-3p	CLIP-seq
MIRT1932924	hsa-miR-4803	CLIP-seq
MIRT1932925	hsa-miR-483-3p	CLIP-seq
MIRT789575	hsa-miR-497	CLIP-seq
MIRT789576	hsa-miR-503	CLIP-seq
MIRT1932926	hsa-miR-570	CLIP-seq
MIRT1932927	hsa-miR-628-5p	CLIP-seq
MIRT1932928	hsa-miR-668	CLIP-seq
MIRT1932929	hsa-miR-762	CLIP-seq
MIRT789551	hsa-miR-103a	CLIP-seq
MIRT789552	hsa-miR-107	CLIP-seq
MIRT2173058	hsa-miR-1252	CLIP-seq
MIRT2173059	hsa-miR-1321	CLIP-seq
MIRT2173060	hsa-miR-1910	CLIP-seq
MIRT2173061	hsa-miR-3166	CLIP-seq
MIRT2173062	hsa-miR-3184	CLIP-seq
MIRT2173063	hsa-miR-3915	CLIP-seq
MIRT2173064	hsa-miR-3928	CLIP-seq
MIRT2173065	hsa-miR-423-5p	CLIP-seq
MIRT2173066	hsa-miR-4270	CLIP-seq
MIRT2173067	hsa-miR-4436b-3p	CLIP-seq
MIRT2173068	hsa-miR-4441	CLIP-seq
MIRT2173069	hsa-miR-4476	CLIP-seq
MIRT789566	hsa-miR-4488	CLIP-seq
MIRT2173070	hsa-miR-4533	CLIP-seq
MIRT2173071	hsa-miR-455-3p	CLIP-seq
MIRT2173072	hsa-miR-4640-5p	CLIP-seq
MIRT2173073	hsa-miR-4685-5p	CLIP-seq
MIRT789570	hsa-miR-4697-5p	CLIP-seq
MIRT2173074	hsa-miR-4726-5p	CLIP-seq
MIRT2173075	hsa-miR-4728-5p	CLIP-seq
MIRT2173076	hsa-miR-4739	CLIP-seq
MIRT2173077	hsa-miR-4756-5p	CLIP-seq
MIRT789576	hsa-miR-503	CLIP-seq
MIRT789554	hsa-miR-15a	CLIP-seq
MIRT789555	hsa-miR-15b	CLIP-seq
MIRT789556	hsa-miR-16	CLIP-seq
MIRT789557	hsa-miR-195	CLIP-seq
MIRT789564	hsa-miR-424	CLIP-seq
MIRT789567	hsa-miR-4503	CLIP-seq
MIRT789575	hsa-miR-497	CLIP-seq
MIRT789576	hsa-miR-503	CLIP-seq
MIRT2443790	hsa-miR-138	CLIP-seq
MIRT1555965	hsa-miR-3136-3p	CLIP-seq
MIRT2443791	hsa-miR-3180	CLIP-seq
MIRT2443792	hsa-miR-3180-3p	CLIP-seq
MIRT2443793	hsa-miR-3196	CLIP-seq
MIRT2443794	hsa-miR-3646	CLIP-seq
MIRT2443795	hsa-miR-3652	CLIP-seq
MIRT2443796	hsa-miR-4260	CLIP-seq
MIRT2443797	hsa-miR-4299	CLIP-seq
MIRT2443798	hsa-miR-4308	CLIP-seq
MIRT2443799	hsa-miR-4430	CLIP-seq
MIRT2443800	hsa-miR-4464	CLIP-seq
MIRT2443801	hsa-miR-4505	CLIP-seq
MIRT2443802	hsa-miR-4748	CLIP-seq
MIRT789572	hsa-miR-4749-3p	CLIP-seq
MIRT2443803	hsa-miR-493	CLIP-seq

Show/Hide all (58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0002026	Process	Regulation of the force of heart contraction	IEA
GO:0002031	Process	G protein-coupled receptor internalization	IDA	10644702
GO:0002031	Process	G protein-coupled receptor internalization	IMP	12582207
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9792798
GO:0005179	Function	Hormone activity	IDA	22810587, 38428423
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	IMP	28137936
GO:0005576	Component	Extracellular region	IDA	28137936
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	22810587, 38428423
GO:0005615	Component	Extracellular space	IDA	22810587, 38428423
GO:0005615	Component	Extracellular space	IEA
GO:0006955	Process	Immune response	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9792798
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	38428423
GO:0007369	Process	Gastrulation	IEA
GO:0007595	Process	Lactation	TAS
GO:0007631	Process	Feeding behavior	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010460	Process	Positive regulation of heart rate	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IC	10644702, 12582207
GO:0010629	Process	Negative regulation of gene expression	IGI	23263626
GO:0031652	Process	Positive regulation of heat generation	IEA
GO:0031704	Function	Apelin receptor binding	IDA	28137936
GO:0031704	Function	Apelin receptor binding	IEA
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IGI	23263626
GO:0042327	Process	Positive regulation of phosphorylation	IEA
GO:0042756	Process	Drinking behavior	IEA
GO:0042756	Process	Drinking behavior	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045776	Process	Negative regulation of blood pressure	ISS
GO:0045823	Process	Positive regulation of heart contraction	IEA
GO:0045823	Process	Positive regulation of heart contraction	ISS
GO:0045906	Process	Negative regulation of vasoconstriction	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050878	Process	Regulation of body fluid levels	IEA
GO:0051461	Process	Positive regulation of corticotropin secretion	IEA
GO:0051466	Process	Positive regulation of corticotropin-releasing hormone secretion	IEA
GO:0060183	Process	Apelin receptor signaling pathway	IDA	22810587
GO:0060183	Process	Apelin receptor signaling pathway	IDA	11359874, 22810587, 38428423
GO:0060183	Process	Apelin receptor signaling pathway	IEA
GO:0060183	Process	Apelin receptor signaling pathway	IMP	38428423
GO:0060183	Process	Apelin receptor signaling pathway	IMP	28137936
GO:0060976	Process	Coronary vasculature development	IEA
GO:0060976	Process	Coronary vasculature development	ISS
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	23263626
GO:1903243	Process	Negative regulation of cardiac muscle hypertrophy in response to stress	ISS	22810587
GO:1903244	Process	Positive regulation of cardiac muscle hypertrophy in response to stress	ISS
GO:1904022	Process	Positive regulation of G protein-coupled receptor internalization	IDA	11359874
GO:1904022	Process	Positive regulation of G protein-coupled receptor internalization	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IMP	23263626
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IDA	23263626

MIM	HGNC	e!Ensembl
300297	16665	ENSG00000171388

Q9ULZ1

Protein name

Apelin (APJ endogenous ligand) [Cleaved into: Apelin-36; Apelin-31; Apelin-28; Apelin-13]

Protein function

Peptide hormone that functions as endogenous ligand for the G-protein-coupled apelin receptor (APLNR/APJ), that plays a role in cadiovascular homeostasis (PubMed:10525157, PubMed:22810587, PubMed:35817871, PubMed:38428423). Functions as a balanc

PDB

8XQE , 8XQF , 8XZG , 8XZH , 8XZJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15360	Apelin	23 → 77	APJ endogenous ligand	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain with highest levels in the frontal cortex, thalamus, hypothalamus and midbrain (PubMed:10617103). Secreted by the mammary gland into the colostrum and the milk. {ECO:0000269|PubMed:10617103}.

Sequence

MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Apelin signaling pathway		Peptide ligand-binding receptors G alpha (i) signalling events

APLN (apelin)