Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8850
Gene name Gene Name - the full gene name approved by the HGNC.
Lysine acetyltransferase 2B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KAT2B
Synonyms (NCBI Gene) Gene synonyms aliases
CAF, P/CAF, PCAF
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p24.3
Summary Summary of gene provided in NCBI Entrez Gene.
CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004327 hsa-miR-181a-5p Western blot, Luciferase reporter assay 18728182
MIRT004328 hsa-miR-181b-5p Western blot, Luciferase reporter assay 18728182
MIRT004329 hsa-miR-25-3p Western blot, Luciferase reporter assay 18728182
MIRT004330 hsa-miR-32-5p Western blot, Luciferase reporter assay 18728182
MIRT004331 hsa-miR-92a-3p Western blot, Luciferase reporter assay 18728182
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 18838386
GO:0000123 Component Histone acetyltransferase complex IEA
GO:0000124 Component SAGA complex NAS 9674425, 17707232, 19114550
GO:0000432 Process Positive regulation of transcription from RNA polymerase II promoter by glucose IEA
GO:0000776 Component Kinetochore IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602303 8638 ENSG00000114166
Protein
UniProt ID Q92831
Protein name Histone acetyltransferase KAT2B (EC 2.3.1.48) (Histone acetyltransferase PCAF) (Histone acetylase PCAF) (Lysine acetyltransferase 2B) (P300/CBP-associated factor) (P/CAF) (Spermidine acetyltransferase KAT2B) (EC 2.3.1.57)
Protein function Functions as a histone acetyltransferase (HAT) to promote transcriptional activation (PubMed:8945521). Has significant histone acetyltransferase activity with core histones (H3 and H4), and also with nucleosome core particles (PubMed:8945521). H
PDB 1CM0 , 1JM4 , 1N72 , 1WUG , 1WUM , 1ZS5 , 2RNW , 2RNX , 3GG3 , 4NSQ , 5FDZ , 5FE0 , 5FE1 , 5FE2 , 5FE3 , 5FE4 , 5FE5 , 5FE6 , 5FE7 , 5FE8 , 5FE9 , 5LVQ , 5LVR , 5MKX , 6J3O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06466 PCAF_N 74 326 PCAF (P300/CBP-associated factor) N-terminal domain Domain
PF00583 Acetyltransf_1 514 622 Acetyltransferase (GNAT) family Family
PF00439 Bromodomain 732 815 Bromodomain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed but most abundant in heart and skeletal muscle. Also expressed in the skin, in keratinocytes (at protein level) (PubMed:20940255). {ECO:0000269|PubMed:20940255, ECO:0000269|PubMed:8684459}.
Sequence
MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAA
AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP
PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED
ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKE
RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
YETTQVFGRTLLRSVFTVMRRQLLEQ
ARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ
NSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG
LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSA
RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD
PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
DILNFLTYADEYAIGYFKKQGF
SKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS
VIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSK
EPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR
YYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANI
LEKFFFSKIKEAGLIDK
Sequence length 832
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Viral life cycle - HIV-1
Notch signaling pathway
Thyroid hormone signaling pathway
Human T-cell leukemia virus 1 infection
Viral carcinogenesis
  Pre-NOTCH Transcription and Translation
YAP1- and WWTR1 (TAZ)-stimulated gene expression
NOTCH1 Intracellular Domain Regulates Transcription
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Notch-HLH transcription pathway
B-WICH complex positively regulates rRNA expression
Physiological factors
Metalloprotease DUBs
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
RUNX3 regulates NOTCH signaling
NOTCH3 Intracellular Domain Regulates Transcription
NOTCH4 Intracellular Domain Regulates Transcription
Estrogen-dependent gene expression
Regulation of FOXO transcriptional activity by acetylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Ischemic Stroke Ischemic stroke N/A N/A GWAS
Stress Disorder Post-traumatic stress disorder N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 25800736, 29301498
Aortic Aneurysm Abdominal Associate 26767057
Atrial Fibrillation Associate 36810794
Attention Deficit Disorder with Hyperactivity Associate 31575856
Bone Diseases Associate 38072145
Breast Neoplasms Associate 15153330, 27881889, 37117180
Carcinoma Basal Cell Associate 29555579
Carcinoma Hepatocellular Inhibit 25855960
Carcinoma Hepatocellular Associate 27350734, 31828297, 34173348
Carcinoma Non Small Cell Lung Associate 22992725, 30453281