Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8850
Gene name	Lysine acetyltransferase 2B
Gene symbol	KAT2B
Synonyms (NCBI Gene)	CAFP/CAFPCAF
Chromosome	3
Chromosome location	3p24.3
Summary	CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vi

230

Show/Hide all (230)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004327	hsa-miR-181a-5p	Western blotLuciferase reporter assay	18728182
MIRT004328	hsa-miR-181b-5p	Western blotLuciferase reporter assay	18728182
MIRT004329	hsa-miR-25-3p	Western blotLuciferase reporter assay	18728182
MIRT004330	hsa-miR-32-5p	Western blotLuciferase reporter assay	18728182
MIRT004331	hsa-miR-92a-3p	Western blotLuciferase reporter assay	18728182
MIRT004332	hsa-miR-93-5p	Western blotLuciferase reporter assay	18728182
MIRT004333	hsa-miR-106b-5p	Western blotLuciferase reporter assay	18728182
MIRT004334	hsa-miR-19a-3p	Western blotLuciferase reporter assay	18728182
MIRT004335	hsa-miR-19b-3p	Western blotLuciferase reporter assay	18728182
MIRT004333	hsa-miR-106b-5p	Luciferase reporter assay	18728182
MIRT004327	hsa-miR-181a-5p	Luciferase reporter assay	18728182
MIRT004328	hsa-miR-181b-5p	Luciferase reporter assay	18728182
MIRT004329	hsa-miR-25-3p	Luciferase reporter assay	18728182
MIRT004330	hsa-miR-32-5p	Luciferase reporter assay	18728182
MIRT004332	hsa-miR-93-5p	Luciferase reporter assay	18728182
MIRT004333	hsa-miR-106b-5p	Microarray	17242205
MIRT024568	hsa-miR-215-5p	Microarray	19074876
MIRT026230	hsa-miR-192-5p	Microarray	19074876
MIRT029198	hsa-miR-26b-5p	Microarray	19088304
MIRT054344	hsa-miR-17-5p	ImmunocytochemistryLuciferase reporter assayqRT-PCRWestern blot	23095762
MIRT209673	hsa-miR-142-3p	MicroarrayqRT-PCR	22815788
MIRT440411	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT440412	hsa-miR-539-5p	HITS-CLIP	24374217
MIRT440411	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT440412	hsa-miR-539-5p	HITS-CLIP	24374217
MIRT004331	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT162309	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT004330	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT1078618	hsa-miR-106a	CLIP-seq
MIRT1078619	hsa-miR-106b	CLIP-seq
MIRT1078620	hsa-miR-1207-3p	CLIP-seq
MIRT1078621	hsa-miR-1226	CLIP-seq
MIRT1078622	hsa-miR-1305	CLIP-seq
MIRT1078623	hsa-miR-137	CLIP-seq
MIRT1078624	hsa-miR-17	CLIP-seq
MIRT1078625	hsa-miR-197	CLIP-seq
MIRT1078626	hsa-miR-200b	CLIP-seq
MIRT1078627	hsa-miR-200c	CLIP-seq
MIRT1078628	hsa-miR-20a	CLIP-seq
MIRT1078629	hsa-miR-20b	CLIP-seq
MIRT1078630	hsa-miR-2277-3p	CLIP-seq
MIRT1078631	hsa-miR-2355-3p	CLIP-seq
MIRT1078632	hsa-miR-25	CLIP-seq
MIRT1078633	hsa-miR-302a	CLIP-seq
MIRT1078634	hsa-miR-302b	CLIP-seq
MIRT1078635	hsa-miR-302c	CLIP-seq
MIRT1078636	hsa-miR-302d	CLIP-seq
MIRT1078637	hsa-miR-302e	CLIP-seq
MIRT1078638	hsa-miR-3120-3p	CLIP-seq
MIRT1078639	hsa-miR-32	CLIP-seq
MIRT1078640	hsa-miR-330-3p	CLIP-seq
MIRT1078641	hsa-miR-338-5p	CLIP-seq
MIRT1078642	hsa-miR-363	CLIP-seq
MIRT1078643	hsa-miR-3660	CLIP-seq
MIRT1078644	hsa-miR-367	CLIP-seq
MIRT1078645	hsa-miR-372	CLIP-seq
MIRT1078646	hsa-miR-373	CLIP-seq
MIRT1078647	hsa-miR-3942-3p	CLIP-seq
MIRT1078648	hsa-miR-429	CLIP-seq
MIRT1078649	hsa-miR-4302	CLIP-seq
MIRT1078650	hsa-miR-433	CLIP-seq
MIRT1078651	hsa-miR-4422	CLIP-seq
MIRT1078652	hsa-miR-450b-5p	CLIP-seq
MIRT1078653	hsa-miR-452	CLIP-seq
MIRT1078654	hsa-miR-4526	CLIP-seq
MIRT1078655	hsa-miR-4646-3p	CLIP-seq
MIRT1078656	hsa-miR-4676-3p	CLIP-seq
MIRT1078657	hsa-miR-4694-5p	CLIP-seq
MIRT1078658	hsa-miR-4733-3p	CLIP-seq
MIRT1078659	hsa-miR-518a-5p	CLIP-seq
MIRT1078660	hsa-miR-519d	CLIP-seq
MIRT1078661	hsa-miR-520a-3p	CLIP-seq
MIRT1078662	hsa-miR-520b	CLIP-seq
MIRT1078663	hsa-miR-520c-3p	CLIP-seq
MIRT1078664	hsa-miR-520d-3p	CLIP-seq
MIRT1078665	hsa-miR-520d-5p	CLIP-seq
MIRT1078666	hsa-miR-520e	CLIP-seq
MIRT1078667	hsa-miR-524-5p	CLIP-seq
MIRT1078668	hsa-miR-527	CLIP-seq
MIRT1078669	hsa-miR-545	CLIP-seq
MIRT1078670	hsa-miR-548aa	CLIP-seq
MIRT1078671	hsa-miR-548ac	CLIP-seq
MIRT1078672	hsa-miR-548c-3p	CLIP-seq
MIRT1078673	hsa-miR-548d-3p	CLIP-seq
MIRT1078674	hsa-miR-548t	CLIP-seq
MIRT1078675	hsa-miR-548z	CLIP-seq
MIRT1078676	hsa-miR-556-3p	CLIP-seq
MIRT1078677	hsa-miR-591	CLIP-seq
MIRT1078678	hsa-miR-607	CLIP-seq
MIRT1078679	hsa-miR-609	CLIP-seq
MIRT1078680	hsa-miR-664	CLIP-seq
MIRT1078681	hsa-miR-676	CLIP-seq
MIRT1078682	hsa-miR-767-3p	CLIP-seq
MIRT1078683	hsa-miR-92a	CLIP-seq
MIRT1078684	hsa-miR-92b	CLIP-seq
MIRT1078685	hsa-miR-93	CLIP-seq
MIRT1078686	hsa-miR-944	CLIP-seq
MIRT1078618	hsa-miR-106a	CLIP-seq
MIRT1078619	hsa-miR-106b	CLIP-seq
MIRT2019590	hsa-miR-1206	CLIP-seq
MIRT2019591	hsa-miR-1236	CLIP-seq
MIRT2019592	hsa-miR-1276	CLIP-seq
MIRT2019593	hsa-miR-142-5p	CLIP-seq
MIRT1078624	hsa-miR-17	CLIP-seq
MIRT1078628	hsa-miR-20a	CLIP-seq
MIRT1078629	hsa-miR-20b	CLIP-seq
MIRT1078633	hsa-miR-302a	CLIP-seq
MIRT1078634	hsa-miR-302b	CLIP-seq
MIRT1078635	hsa-miR-302c	CLIP-seq
MIRT1078636	hsa-miR-302d	CLIP-seq
MIRT1078637	hsa-miR-302e	CLIP-seq
MIRT2019594	hsa-miR-3133	CLIP-seq
MIRT2019595	hsa-miR-323b-5p	CLIP-seq
MIRT2019596	hsa-miR-340	CLIP-seq
MIRT1078645	hsa-miR-372	CLIP-seq
MIRT1078646	hsa-miR-373	CLIP-seq
MIRT2019597	hsa-miR-376a	CLIP-seq
MIRT2019598	hsa-miR-376b	CLIP-seq
MIRT2019599	hsa-miR-4311	CLIP-seq
MIRT2019600	hsa-miR-4775	CLIP-seq
MIRT2019601	hsa-miR-4796-5p	CLIP-seq
MIRT2019602	hsa-miR-487a	CLIP-seq
MIRT2019603	hsa-miR-499-3p	CLIP-seq
MIRT2019604	hsa-miR-499a-3p	CLIP-seq
MIRT1078660	hsa-miR-519d	CLIP-seq
MIRT1078661	hsa-miR-520a-3p	CLIP-seq
MIRT1078662	hsa-miR-520b	CLIP-seq
MIRT1078663	hsa-miR-520c-3p	CLIP-seq
MIRT1078664	hsa-miR-520d-3p	CLIP-seq
MIRT1078666	hsa-miR-520e	CLIP-seq
MIRT2019605	hsa-miR-548b-3p	CLIP-seq
MIRT1078674	hsa-miR-548t	CLIP-seq
MIRT1078676	hsa-miR-556-3p	CLIP-seq
MIRT2019606	hsa-miR-568	CLIP-seq
MIRT2019607	hsa-miR-579	CLIP-seq
MIRT2019608	hsa-miR-583	CLIP-seq
MIRT2019609	hsa-miR-584	CLIP-seq
MIRT1078685	hsa-miR-93	CLIP-seq
MIRT1078686	hsa-miR-944	CLIP-seq
MIRT2019590	hsa-miR-1206	CLIP-seq
MIRT1078623	hsa-miR-137	CLIP-seq
MIRT1078632	hsa-miR-25	CLIP-seq
MIRT1078639	hsa-miR-32	CLIP-seq
MIRT1078641	hsa-miR-338-5p	CLIP-seq
MIRT1078642	hsa-miR-363	CLIP-seq
MIRT1078644	hsa-miR-367	CLIP-seq
MIRT1078650	hsa-miR-433	CLIP-seq
MIRT2019603	hsa-miR-499-3p	CLIP-seq
MIRT2019604	hsa-miR-499a-3p	CLIP-seq
MIRT2019607	hsa-miR-579	CLIP-seq
MIRT1078677	hsa-miR-591	CLIP-seq
MIRT1078680	hsa-miR-664	CLIP-seq
MIRT1078683	hsa-miR-92a	CLIP-seq
MIRT1078684	hsa-miR-92b	CLIP-seq
MIRT2442281	hsa-miR-1343	CLIP-seq
MIRT2442282	hsa-miR-3074-5p	CLIP-seq
MIRT2442283	hsa-miR-3124-3p	CLIP-seq
MIRT2442284	hsa-miR-3160-5p	CLIP-seq
MIRT1078640	hsa-miR-330-3p	CLIP-seq
MIRT2442285	hsa-miR-3690	CLIP-seq
MIRT2442286	hsa-miR-4254	CLIP-seq
MIRT1078620	hsa-miR-1207-3p	CLIP-seq
MIRT2554742	hsa-miR-1208	CLIP-seq
MIRT2554743	hsa-miR-1297	CLIP-seq
MIRT1078622	hsa-miR-1305	CLIP-seq
MIRT2554744	hsa-miR-185	CLIP-seq
MIRT2554745	hsa-miR-188-5p	CLIP-seq
MIRT2554746	hsa-miR-205	CLIP-seq
MIRT2554747	hsa-miR-214	CLIP-seq
MIRT2554748	hsa-miR-216a	CLIP-seq
MIRT1078630	hsa-miR-2277-3p	CLIP-seq
MIRT2554749	hsa-miR-26a	CLIP-seq
MIRT2554750	hsa-miR-26b	CLIP-seq
MIRT2554751	hsa-miR-27a	CLIP-seq
MIRT2554752	hsa-miR-27b	CLIP-seq
MIRT1078638	hsa-miR-3120-3p	CLIP-seq
MIRT2554753	hsa-miR-3126-3p	CLIP-seq
MIRT2019595	hsa-miR-323b-5p	CLIP-seq
MIRT1078640	hsa-miR-330-3p	CLIP-seq
MIRT2554754	hsa-miR-337-3p	CLIP-seq
MIRT2554755	hsa-miR-3607-5p	CLIP-seq
MIRT2554756	hsa-miR-3619-5p	CLIP-seq
MIRT2554757	hsa-miR-3667-3p	CLIP-seq
MIRT2554758	hsa-miR-3685	CLIP-seq
MIRT2554759	hsa-miR-3713	CLIP-seq
MIRT2554760	hsa-miR-384	CLIP-seq
MIRT2554761	hsa-miR-3977	CLIP-seq
MIRT2554762	hsa-miR-4280	CLIP-seq
MIRT2554763	hsa-miR-4291	CLIP-seq
MIRT2554764	hsa-miR-4306	CLIP-seq
MIRT1078651	hsa-miR-4422	CLIP-seq
MIRT2554765	hsa-miR-4426	CLIP-seq
MIRT2554766	hsa-miR-4456	CLIP-seq
MIRT2554767	hsa-miR-4465	CLIP-seq
MIRT1078653	hsa-miR-452	CLIP-seq
MIRT2554768	hsa-miR-4520a-3p	CLIP-seq
MIRT2554769	hsa-miR-455-3p	CLIP-seq
MIRT2554770	hsa-miR-4638-3p	CLIP-seq
MIRT2554771	hsa-miR-4644	CLIP-seq
MIRT2554772	hsa-miR-4647	CLIP-seq
MIRT2554773	hsa-miR-4662b	CLIP-seq
MIRT1078656	hsa-miR-4676-3p	CLIP-seq
MIRT2554774	hsa-miR-4729	CLIP-seq
MIRT2554775	hsa-miR-4733-5p	CLIP-seq
MIRT2019600	hsa-miR-4775	CLIP-seq
MIRT2554776	hsa-miR-4777-3p	CLIP-seq
MIRT2554777	hsa-miR-4786-5p	CLIP-seq
MIRT2554778	hsa-miR-491-3p	CLIP-seq
MIRT2554779	hsa-miR-498	CLIP-seq
MIRT2554780	hsa-miR-513a-5p	CLIP-seq
MIRT2554781	hsa-miR-516b	CLIP-seq
MIRT1078665	hsa-miR-520d-5p	CLIP-seq
MIRT1078667	hsa-miR-524-5p	CLIP-seq
MIRT2554782	hsa-miR-541	CLIP-seq
MIRT1078669	hsa-miR-545	CLIP-seq
MIRT1078670	hsa-miR-548aa	CLIP-seq
MIRT2554783	hsa-miR-548g	CLIP-seq
MIRT2019606	hsa-miR-568	CLIP-seq
MIRT2019607	hsa-miR-579	CLIP-seq
MIRT2019609	hsa-miR-584	CLIP-seq
MIRT2554784	hsa-miR-605	CLIP-seq
MIRT2554785	hsa-miR-634	CLIP-seq
MIRT2554786	hsa-miR-654-5p	CLIP-seq
MIRT2554787	hsa-miR-656	CLIP-seq
MIRT2554788	hsa-miR-761	CLIP-seq
MIRT2554789	hsa-miR-769-5p	CLIP-seq
MIRT2554790	hsa-miR-873	CLIP-seq
MIRT2554791	hsa-miR-922	CLIP-seq
MIRT2554775	hsa-miR-4733-5p	CLIP-seq
MIRT2554783	hsa-miR-548g	CLIP-seq

115

Show/Hide all (115)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18838386
GO:0000123	Component	Histone acetyltransferase complex	IEA
GO:0000124	Component	SAGA complex	NAS	9674425, 17707232, 19114550
GO:0000432	Process	Positive regulation of transcription from RNA polymerase II promoter by glucose	IEA
GO:0000776	Component	Kinetochore	IEA
GO:0000785	Component	Chromatin	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0003712	Function	Transcription coregulator activity	IPI	8684459
GO:0003713	Function	Transcription coactivator activity	IDA	12435739, 14645221
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0004145	Function	Diamine N-acetyltransferase activity	IEA
GO:0004402	Function	Histone acetyltransferase activity	EXP	23555303
GO:0004402	Function	Histone acetyltransferase activity	IDA	14645221
GO:0004402	Function	Histone acetyltransferase activity	IEA
GO:0004402	Function	Histone acetyltransferase activity	IMP	16829519
GO:0004468	Function	L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IDA	19303849, 19470756, 23932781
GO:0004468	Function	L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IEA
GO:0004468	Function	L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	ISS
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	ISS
GO:0005515	Function	Protein binding	IPI	8684459, 9674425, 9687513, 11568182, 12435739, 12743606, 12813456, 12887892, 14645221, 15273251, 16322561, 16332960, 16415179, 16543236, 16617118, 17301242, 18504427, 19188449, 19303849, 19407811, 22575646, 23932781, 24492005, 24825348, 26867678, 27796307, 29174768, 32814053, 338944
GO:0005634	Component	Nucleus	IDA	25593309, 27796307
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	10891508
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	39881208
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	27796307
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006282	Process	Regulation of DNA repair	NAS	11564863
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IDA	17707232
GO:0006338	Process	Chromatin remodeling	NAS	10365964
GO:0006338	Process	Chromatin remodeling	TAS	8684459
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	17694077
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006473	Process	Protein acetylation	IDA	15273251, 26867678
GO:0006473	Process	Protein acetylation	TAS	8684459
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	23932781
GO:0006633	Process	Fatty acid biosynthetic process	IDA	10653665, 19286649
GO:0007507	Process	Heart development	ISS
GO:0007613	Process	Memory	IEA
GO:0008047	Function	Enzyme activator activity	IDA	19470756
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	8684459
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010484	Function	Histone H3 acetyltransferase activity	IBA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0016407	Function	Acetyltransferase activity	IDA	8684459, 15273251, 17301242
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0018076	Process	N-terminal peptidyl-lysine acetylation	IDA	12435739
GO:0018393	Process	Internal peptidyl-lysine acetylation	IDA	23932781, 27796307, 29174768
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	ISS
GO:0031672	Component	A band	IEA
GO:0031674	Component	I band	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IDA	19303849
GO:0032991	Component	Protein-containing complex	IDA	15273251
GO:0032991	Component	Protein-containing complex	IPI	17707232
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0035035	Function	Histone acetyltransferase binding	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042641	Component	Actomyosin	IEA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	12887892
GO:0043484	Process	Regulation of RNA splicing	NAS	11564863
GO:0043992	Function	Histone H3K9 acetyltransferase activity	IDA	21131905
GO:0043992	Function	Histone H3K9 acetyltransferase activity	IEA
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	IDA	23932781
GO:0045722	Process	Positive regulation of gluconeogenesis	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IDA	23932781
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	TAS
GO:0045821	Process	Positive regulation of glycolytic process	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	18206972
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19470756
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045995	Process	Regulation of embryonic development	ISS
GO:0046600	Process	Negative regulation of centriole replication	IDA	27796307
GO:0046600	Process	Negative regulation of centriole replication	IEA
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0051302	Process	Regulation of cell division	ISS
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IDA	23001180
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0051726	Process	Regulation of cell cycle	TAS	8684459
GO:0060173	Process	Limb development	ISS
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IDA	23001180, 23932781, 26867678, 27796307, 29174768
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IEA
GO:0061733	Function	Protein-lysine-acetyltransferase activity	TAS
GO:0062012	Process	Regulation of small molecule metabolic process	IEA
GO:0071374	Process	Cellular response to parathyroid hormone stimulus	IEA
GO:0072686	Component	Mitotic spindle	NAS	20562830
GO:0110076	Process	Negative regulation of ferroptosis	IDA	35922516
GO:0110076	Process	Negative regulation of ferroptosis	IMP	31634899
GO:0110076	Process	Negative regulation of ferroptosis	IMP	39881208
GO:0140297	Function	DNA-binding transcription factor binding	IPI	15509593, 17301242, 17505058
GO:0140672	Component	ATAC complex	IBA
GO:0140672	Component	ATAC complex	IDA	18838386
GO:0140672	Component	ATAC complex	IEA
GO:0140672	Component	ATAC complex	ISO
GO:1902425	Process	Positive regulation of attachment of mitotic spindle microtubules to kinetochore	IDA	23001180
GO:2000233	Process	Negative regulation of rRNA processing	IDA	26867678

MIM	HGNC	e!Ensembl
602303	8638	ENSG00000114166

Q92831

Protein name

Histone acetyltransferase KAT2B (EC 2.3.1.48) (Histone acetyltransferase PCAF) (Histone acetylase PCAF) (Lysine acetyltransferase 2B) (P300/CBP-associated factor) (P/CAF) (Spermidine acetyltransferase KAT2B) (EC 2.3.1.57)

Protein function

Functions as a histone acetyltransferase (HAT) to promote transcriptional activation (PubMed:8945521). Has significant histone acetyltransferase activity with core histones (H3 and H4), and also with nucleosome core particles (PubMed:8945521). H

PDB

1CM0 , 1JM4 , 1N72 , 1WUG , 1WUM , 1ZS5 , 2RNW , 2RNX , 3GG3 , 4NSQ , 5FDZ , 5FE0 , 5FE1 , 5FE2 , 5FE3 , 5FE4 , 5FE5 , 5FE6 , 5FE7 , 5FE8 , 5FE9 , 5LVQ , 5LVR , 5MKX , 6J3O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06466	PCAF_N	74 → 326	PCAF (P300/CBP-associated factor) N-terminal domain	Domain
PF00583	Acetyltransf_1	514 → 622	Acetyltransferase (GNAT) family	Family
PF00439	Bromodomain	732 → 815	Bromodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed but most abundant in heart and skeletal muscle. Also expressed in the skin, in keratinocytes (at protein level) (PubMed:20940255). {ECO:0000269|PubMed:20940255, ECO:0000269|PubMed:8684459}.

Sequence

MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAA
AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP
PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED
ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKE
RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
YETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ
NSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG
LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSA
RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD
PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS
VIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSK
EPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR
YYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK

Sequence length

832

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1 Notch signaling pathway Thyroid hormone signaling pathway Human T-cell leukemia virus 1 infection Viral carcinogenesis		Pre-NOTCH Transcription and Translation YAP1- and WWTR1 (TAZ)-stimulated gene expression NOTCH1 Intracellular Domain Regulates Transcription Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants Notch-HLH transcription pathway B-WICH complex positively regulates rRNA expression Physiological factors Metalloprotease DUBs RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function RUNX3 regulates NOTCH signaling NOTCH3 Intracellular Domain Regulates Transcription NOTCH4 Intracellular Domain Regulates Transcription Estrogen-dependent gene expression Regulation of FOXO transcriptional activity by acetylation

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs78154827	RCV005919490
Cervical cancer	Benign	rs78154827	RCV005919492
Cholangiocarcinoma	Benign	rs2293141	RCV005921629
Hepatocellular carcinoma	Benign	rs2293141	RCV005921627
KAT2B-related disorder	Uncertain significance; Likely benign; Benign	rs1227332251, rs995249037, rs200560854, rs2470387106, rs150884035, rs1003611326, rs1167724402, rs1575130227, rs532817681, rs150351875, rs201810024, rs116196143, rs555906565, rs1697691490, rs141010149 View all (4 more)	RCV003900907 RCV003946404 RCV004756506 RCV003400204 RCV003908940 RCV003897046 RCV003893845 RCV003894115 RCV003903971 RCV003979457 RCV003909636 RCV003917166 RCV003941549 RCV003939606 RCV003949311 RCV003934620 RCV003962219 RCV003976334 RCV003916150
Malignant lymphoma, large B-cell, diffuse	Benign	rs2293141, rs17006623	RCV005921628 RCV005924503
Malignant tumor of esophagus	Benign	rs78154827	RCV005919491
Sarcoma	Benign	rs78154827, rs9860573	RCV005919493 RCV005920018
Thymoma	Benign	rs78154827	RCV005919494

Show/Hide Text Mining Associations (64)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	25800736, 29301498
Aortic Aneurysm Abdominal	Associate	26767057
Atrial Fibrillation	Associate	36810794
Attention Deficit Disorder with Hyperactivity	Associate	31575856
Bone Diseases	Associate	38072145
Breast Neoplasms	Associate	15153330, 27881889, 37117180
Carcinoma Basal Cell	Associate	29555579
Carcinoma Hepatocellular	Inhibit	25855960
Carcinoma Hepatocellular	Associate	27350734, 31828297, 34173348
Carcinoma Non Small Cell Lung	Associate	22992725, 30453281
Carcinoma Pancreatic Ductal	Associate	23696899, 36849201
Carcinoma Squamous Cell	Associate	29555579
Cardiovascular Diseases	Associate	32239175
Colitis Ulcerative	Associate	28751935
Death	Associate	36894612
Diabetes Mellitus Type 2	Associate	11296231, 26634513
Ectodermal Dysplasia	Inhibit	37887281
Esophageal Squamous Cell Carcinoma	Associate	28518141, 34555274
GATA2 Deficiency	Stimulate	36849201
Glioblastoma	Associate	25501279, 25712375
Glioma	Associate	25712375
Heart Defects Congenital	Associate	32239175
Heart Failure	Associate	37092838
Hypoxia	Stimulate	25025381
Inflammation	Associate	32549759
Kidney Failure Chronic	Associate	25025381
Leukemia	Associate	28053092
Leukemia Promyelocytic Acute	Associate	28053092
Lung Neoplasms	Associate	29301498, 31908099, 31908141
Lupus Erythematosus Systemic	Associate	25611806
Lymphatic Metastasis	Associate	21854747
Lymphatic Metastasis	Inhibit	34130593
Lymphoma	Associate	34631879
Maturity Onset Diabetes of the Young Type 3	Associate	11296231
Melanoma	Associate	29555579
Monosomy	Inhibit	25593028
Mucocutaneous Lymph Node Syndrome	Inhibit	25025381
Nasopharyngeal Carcinoma	Associate	29685955, 32083569
Neoplasm Metastasis	Associate	31908141
Neoplasm Metastasis	Inhibit	34555274
Neoplasms	Associate	12402157, 16638127, 19188449, 20491776, 21854747, 25593028, 25712375, 27881889, 28518141, 28751935, 29555579, 31545241, 31908099, 31908141, 32966758 View all (6 more)
Neoplasms	Inhibit	29670108
Nerve Degeneration	Associate	36894612
Neurodegenerative Diseases	Associate	36894612
Obesity	Associate	29500370
Osteoarthritis	Stimulate	19479829
Osteoporosis	Associate	38072145
Osteosarcoma	Associate	31545241
Ovarian Neoplasms	Associate	30678426, 37828084
Pancreatic Neoplasms	Associate	36200682, 36849201
Pancreatitis	Associate	32549759, 33589694
Polycystic Kidney Autosomal Dominant	Associate	15327388
Polycystic Kidney Autosomal Recessive	Associate	15327388
Prostatic Neoplasms	Associate	23095762, 24294372
Prostatic Neoplasms	Inhibit	30833716
Retinoblastoma	Associate	37603355
Rhabdomyosarcoma	Associate	17468105
Squamous Cell Carcinoma of Head and Neck	Associate	36148955
Stomach Neoplasms	Associate	21854747, 26168960
Stomach Neoplasms	Inhibit	24668547, 29670108
Uremia	Inhibit	25025381
Urethral Neoplasms	Associate	20491776, 28678170
Uterine Cervical Neoplasms	Inhibit	34130593
Uveal melanoma	Associate	25593028

KAT2B (lysine acetyltransferase 2B)