Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8840
Gene name Gene Name - the full gene name approved by the HGNC.	Cellular communication network factor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCN4
Synonyms (NCBI Gene) Gene synonyms aliases	WISP1, WISP1-OT1, WISP1-UT1, WISP1c, WISP1i, WISP1tc
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.22
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate di

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001817	Process	Regulation of cytokine production	IDA	25281430
GO:0005178	Function	Integrin binding	IBA
GO:0005515	Function	Protein binding	IPI	11598131, 20684029, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	25281430
GO:0005615	Component	Extracellular space	NAS	9843955
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9843955
GO:0007267	Process	Cell-cell signaling	TAS	9843955
GO:0008201	Function	Heparin binding	IBA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	ISS
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IBA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IMP	20684029
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IDA	25281430
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0060348	Process	Bone development	IEA
GO:0090303	Process	Positive regulation of wound healing	IEA

MIM	HGNC	e!Ensembl
603398	12769	ENSG00000104415

Protein

UniProt ID

O95388

Protein name

CCN family member 4 (WNT1-inducible-signaling pathway protein 1) (WISP-1) (Wnt-1-induced secreted protein)

Protein function

Downstream regulator in the Wnt/Frizzled-signaling pathway. Associated with cell survival. Attenuates p53-mediated apoptosis in response to DNA damage through activation of AKT kinase. Up-regulates the anti-apoptotic Bcl-X(L) protein. Adheres to

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00219	IGFBP	49 → 101	Insulin-like growth factor binding protein	Domain
PF00093	VWC	123 → 185	von Willebrand factor type C domain	Family
PF19035	TSP1_CCN	216 → 259	CCN3 Nov like TSP1 domain	Domain
PF00007	Cys_knot	270 → 363	Cystine-knot domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, kidney, lung, pancreas, placenta, ovary, small intestine and spleen. Isoform 2 is expressed predominantly in scirrhous gastric carcinoma and, weakly in placenta. Overexpression is associated with several cancers inc

Sequence

MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPP
RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVG
VGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCC
EQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISN
VNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKY
CGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYP
DFSEIAN

Sequence length

367

Interactions

View interactions

	KEGG
	Wnt signaling pathway

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Endometriosis	Endometriosis	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (50)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	36640859
Alzheimer Disease	Associate	22873724
Arthritis Rheumatoid	Associate	31689765, 32361708
Bone Diseases	Associate	20362080
Breast Neoplasms	Stimulate	24426833, 25732125
Breast Neoplasms	Associate	31689877, 35481425
Carcinogenesis	Associate	17579708, 17657846, 25732125, 28426731, 29889892, 33239483
Carcinoma Hepatocellular	Associate	29889892, 33155200, 33239483
Carcinoma Renal Cell	Associate	29282485, 39754169
Cluster Headache	Associate	40114078
Colorectal Neoplasms	Associate	20372786, 25782664
Diabetes Mellitus Type 2	Associate	29690638
Drug Related Side Effects and Adverse Reactions	Associate	25405734, 36640859
Dysequilibrium syndrome	Associate	32964955
Esophageal Squamous Cell Carcinoma	Associate	34057837
Fibromatosis Aggressive	Associate	24402778
Fibrosis	Associate	33946738, 39682753
Gastrointestinal Diseases	Associate	25405734
Hematologic Diseases	Associate	25405734
Hemimegalencephaly	Associate	16196383
Idiopathic Pulmonary Fibrosis	Stimulate	39682753
Inflammation	Associate	32830547
Insulin Resistance	Associate	33946738
Kashin Beck Disease	Associate	31220921, 38003226
Kidney Failure Chronic	Associate	31689877
Liver Cirrhosis	Associate	33946738
Lung Neoplasms	Inhibit	12529380
Lung Neoplasms	Associate	17579708, 25405734
Lymphatic Metastasis	Associate	28426731
Lymphatic Metastasis	Stimulate	33155200
Malformations of Cortical Development Group I	Associate	29282485
Myocardial Infarction	Associate	27391264
Necrosis	Associate	29282485
Neoplasm Metastasis	Inhibit	12529380, 35481425
Neoplasm Metastasis	Associate	25277191, 26824419, 33155200
Neoplasms	Associate	11707154, 20372786, 24402778, 24426833, 24477574, 26553456, 28426731, 31636474, 35481425, 36232736
Neoplasms	Inhibit	36640859
Neoplasms Squamous Cell	Associate	33593111
Obesity	Associate	33946738
Obesity Abdominal	Associate	33946738
Osteoarthritis	Associate	18775662, 26293784, 32830547, 32964955
Osteoarthritis	Stimulate	23343403
Osteoarthritis Knee	Associate	26293784
Osteoporosis	Associate	29739999
Prostatic Neoplasms	Associate	25277191
Pulmonary Fibrosis	Associate	26867691, 35387687
Rectal Neoplasms	Stimulate	17657846
Sick Sinus Syndrome	Stimulate	20372786
Squamous Cell Carcinoma of Head and Neck	Associate	24205072, 26824419, 28426731, 33593111
Stomach Neoplasms	Associate	27633176, 28618940, 31636474

CCN4 (cellular communication network factor 4)