CCN4 (cellular communication network factor 4)

Gene

• Entrez ID: 8840
• Gene name: Cellular communication network factor 4
• Gene symbol: CCN4
• Synonyms (NCBI Gene): WISP1, WISP1-OT1, WISP1-UT1, WISP1c, WISP1i, WISP1tc
• Chromosome: 8
• Chromosome location: 8q24.22
• Summary: This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate di

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001817	Process	Regulation of cytokine production	IDA	25281430
GO:0005178	Function	Integrin binding	IBA
GO:0005515	Function	Protein binding	IPI	11598131, 20684029, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	25281430
GO:0005615	Component	Extracellular space	NAS	9843955
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9843955
GO:0007267	Process	Cell-cell signaling	TAS	9843955
GO:0008201	Function	Heparin binding	IBA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	ISS
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IBA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IMP	20684029
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IDA	25281430
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0060348	Process	Bone development	IEA
GO:0090303	Process	Positive regulation of wound healing	IEA

Other IDs

• MIM: 603398
• HGNC: 12769
• e!Ensembl: ENSG00000104415

Protein

• UniProt ID: O95388
• Protein name: CCN family member 4 (WNT1-inducible-signaling pathway protein 1) (WISP-1) (Wnt-1-induced secreted protein)
• Protein function: Downstream regulator in the Wnt/Frizzled-signaling pathway. Associated with cell survival. Attenuates p53-mediated apoptosis in response to DNA damage through activation of AKT kinase. Up-regulates the anti-apoptotic Bcl-X(L) protein. Adheres to
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00219	IGFBP	49 → 101	Insulin-like growth factor binding protein	Domain
  PF00093	VWC	123 → 185	von Willebrand factor type C domain	Family
  PF19035	TSP1_CCN	216 → 259	CCN3 Nov like TSP1 domain	Domain
  PF00007	Cys_knot	270 → 363	Cystine-knot domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, kidney, lung, pancreas, placenta, ovary, small intestine and spleen. Isoform 2 is expressed predominantly in scirrhous gastric carcinoma and, weakly in placenta. Overexpression is associated with several cancers inc
• Sequence:

  MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPP
  RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVG
  VGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCC
  EQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISN
  VNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKY
  CGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYP
  DFSEIAN

• Sequence length: 367

Pathways

KEGG:

Wnt signaling pathway