Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8832
Gene name Gene Name - the full gene name approved by the HGNC.
CD84 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD84
Synonyms (NCBI Gene) Gene synonyms aliases
LY9B, SLAMF5, hCD84, mCD84
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molec
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT624384 hsa-miR-501-5p HITS-CLIP 23824327
MIRT640164 hsa-miR-4691-5p HITS-CLIP 23824327
MIRT640163 hsa-miR-6792-3p HITS-CLIP 23824327
MIRT640162 hsa-miR-6749-3p HITS-CLIP 23824327
MIRT624383 hsa-miR-6505-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0005515 Function Protein binding IPI 12928397, 23322602
GO:0005886 Component Plasma membrane IDA
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane TAS 9310491
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604513 1704 ENSG00000066294
Protein
UniProt ID Q9UIB8
Protein name SLAM family member 5 (Cell surface antigen MAX.3) (Hly9-beta) (Leukocyte differentiation antigen CD84) (Signaling lymphocytic activation molecule 5) (CD antigen CD84)
Protein function Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and
PDB 2PKD
Family and domains
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in hematopoietic tissues, such as lymph node, spleen and peripheral leukocytes. Expressed in macrophages, B-cells, monocytes, platelets, thymocytes, T-cells and dendritic cells. Highly expressed in memory T-cell
Sequence
MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSV
AYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTT
TKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQI
FQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLIL
SSVFLFRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYTYIMASRNTQPAESRIYDEIL
QSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
Sequence length 345
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Cell surface interactions at the vascular wall
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Dermatitis Dermatitis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 30514120
Blood Platelet Disorders Associate 24635044
Breast Neoplasms Associate 40571312
Carcinoma Non Small Cell Lung Inhibit 36969247
Carcinoma Squamous Cell Associate 36969247
Cerebral Arterial Diseases Associate 24635044
Coronary Artery Disease Stimulate 24635044
Inflammation Associate 24635044
Leukemia Lymphocytic Chronic B Cell Associate 23435417
Lupus Erythematosus Systemic Associate 22549634, 35603218