Gene Gene information from NCBI Gene database.
Entrez ID 8832
Gene name CD84 molecule
Gene symbol CD84
Synonyms (NCBI Gene)
LY9BSLAMF5hCD84mCD84
Chromosome 1
Chromosome location 1q23.3
Summary This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molec
miRNA miRNA information provided by mirtarbase database.
422
miRTarBase ID miRNA Experiments Reference
MIRT624384 hsa-miR-501-5p HITS-CLIP 23824327
MIRT640164 hsa-miR-4691-5p HITS-CLIP 23824327
MIRT640163 hsa-miR-6792-3p HITS-CLIP 23824327
MIRT640162 hsa-miR-6749-3p HITS-CLIP 23824327
MIRT624383 hsa-miR-6505-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 12928397, 23322602
GO:0005886 Component Plasma membrane IDA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604513 1704 ENSG00000066294
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UIB8
Protein name SLAM family member 5 (Cell surface antigen MAX.3) (Hly9-beta) (Leukocyte differentiation antigen CD84) (Signaling lymphocytic activation molecule 5) (CD antigen CD84)
Protein function Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and
PDB 2PKD
Family and domains
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in hematopoietic tissues, such as lymph node, spleen and peripheral leukocytes. Expressed in macrophages, B-cells, monocytes, platelets, thymocytes, T-cells and dendritic cells. Highly expressed in memory T-cell
Sequence
MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSV
AYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTT
TKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQI
FQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLIL
SSVFLFRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYTYIMASRNTQPAESRIYDEIL
QSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
Sequence length 345
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Cell surface interactions at the vascular wall
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Multisystem inflammatory syndrome in children risk factor rs2102180282 RCV001779421
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 30514120
Blood Platelet Disorders Associate 24635044
Breast Neoplasms Associate 40571312
Carcinoma Non Small Cell Lung Inhibit 36969247
Carcinoma Squamous Cell Associate 36969247
Cerebral Arterial Diseases Associate 24635044
Coronary Artery Disease Stimulate 24635044
Inflammation Associate 24635044
Leukemia Lymphocytic Chronic B Cell Associate 23435417
Lupus Erythematosus Systemic Associate 22549634, 35603218