Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8829
Gene name Gene Name - the full gene name approved by the HGNC.
Neuropilin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NRP1
Synonyms (NCBI Gene) Gene synonyms aliases
BDCA4, CD304, NP1, NRP, VEGF165R
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p11.22
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, mad
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001352 hsa-miR-1-3p pSILAC 18668040
MIRT017659 hsa-miR-335-5p Microarray 18185580
MIRT021183 hsa-miR-186-5p Sequencing 20371350
MIRT022578 hsa-miR-124-3p Microarray 18668037
MIRT001352 hsa-miR-1-3p Proteomics;Other 18668040
Transcription factors
Transcription factor Regulation Reference
REST Repression 16330548
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IMP 23639442
GO:0001525 Process Angiogenesis ISS 24401374
GO:0001569 Process Branching involved in blood vessel morphogenesis ISS 24401374
GO:0001764 Process Neuron migration ISS
GO:0001938 Process Positive regulation of endothelial cell proliferation TAS 21245381
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602069 8004 ENSG00000099250
Protein
UniProt ID O14786
Protein name Neuropilin-1 (Vascular endothelial cell growth factor 165 receptor) (CD antigen CD304)
Protein function Cell-surface receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. Mediates the chemorepulsant activity of semaphorins (
PDB 1KEX , 2QQI , 2QQM , 2QQN , 3I97 , 4DEQ , 4RN5 , 5C7G , 5IJR , 5IYY , 5J1X , 5JGI , 5JGQ , 5JHK , 5L73 , 6FMC , 6FMF , 6TKK , 7JJC , 7O1N , 7P5U , 8C5G , 8PFE , 9EOU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00431 CUB 27 138 CUB domain Domain
PF00431 CUB 147 262 CUB domain Domain
PF00754 F5_F8_type_C 290 421 F5/8 type C domain Domain
PF00754 F5_F8_type_C 446 580 F5/8 type C domain Domain
PF00629 MAM 650 810 MAM domain, meprin/A5/mu Domain
PF11980 DUF3481 842 923 C-terminal domain of neuropilin glycoprotein Family
Tissue specificity TISSUE SPECIFICITY: [Isoform 1]: The expression of isoforms 1 and 2 does not seem to overlap. Expressed in olfactory epithelium (at protein level) (PubMed:33082293). Expressed in fibroblasts (at protein level) (PubMed:36213313). Expressed by the blood ves
Sequence
MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF
IKFVSDYETHGAGFSIRY
EIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVP
KMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANY
SVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKI
DVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE
V
YGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSY
INEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSF
EGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMEL
LGCEVEAPTAGPTTPNGNLV
DECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTF
CHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAH
CMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVI
FEGEIGKGNLGGIAVDDISINNHISQEDCA
KPADLDKKNPEIKIDETGSTPGYEGEGEGD
KNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYN
FELVDGVKLKKDKLNTQSTYSEA
Sequence length 923
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Axon guidance
Human T-cell leukemia virus 1 infection
Coronavirus disease - COVID-19
  Neurophilin interactions with VEGF and VEGFR
Sema3A PAK dependent Axon repulsion
SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion
CRMPs in Sema3A signaling
Signal transduction by L1
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Migraine Migraine Disorders rs794727411 27322543
Pancreatic cancer Malignant neoplasm of pancreas rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431 15956974
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 17013881
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 21063030 ClinVar
Congenital Heart Disease congenital heart disease GenCC
Tetralogy of Fallot Tetralogy of Fallot GWAS
Coronary artery disease Coronary artery disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 33937395
Adenocarcinoma of Lung Associate 33461176, 33850110
Adrenocortical Carcinoma Associate 33937395
Agnosia Stimulate 31282408
AMR Syndrome Associate 38453145
Amyotrophic lateral sclerosis 1 Associate 35853630
Arteriovenous Malformations Associate 21921738
Arthritis Associate 22697500
Arthritis Psoriatic Inhibit 29790686
Arthritis Rheumatoid Associate 18292234, 22251373